KEGG   Entamoeba dispar: EDI_204080Help
Entry
EDI_204080        CDS       T01083                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
edi  Entamoeba dispar
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 311 aa AA seqDB search
MEEETFNWNTIESDPGVFNEMVKNLGCDDIQFKEIFSFDDSATFERIKPIKGFILLFEYN
KQAINYIRNEYSFIETNEYPDIFFAEQVVQNACATQAILSTLMNIPNINLGPTLQQFKNQ
TLPLNPHERGLAIGNNEIIRKTHNDFAQPSEILEHKISKKLKGVEGRAYHFISIIPYNGI
LLLLDGLSEGPIIIGGADENWPITGMKPFFEGLISAMQGSLEFTLLAVVQDQIKKYQELY
ENAIAEKNEYQIEIYKDIIDEEKKIKEQQHKENKRRKHDYMPLALNLILFLGKHHKLEQE
VEKQINEITKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaacatttaactggaataccattgaatctgatcctggagtatttaatgaa
atggtaaaaaatttaggatgtgatgacattcaatttaaagaaatattttcttttgatgac
tctgctacttttgaacgaattaaaccaataaaaggatttattttattatttgaatacaat
aaacaagcaataaattatataagaaatgaatatagttttattgaaacaaatgaatatcct
gatattttctttgctgaacaagttgttcaaaacgcatgtgctactcaagcaatattatcg
acattaatgaacatcccaaatattaacctaggaccaactttacaacaatttaaaaatcag
acattaccattaaatcctcatgaacgtggattggctattggaaataatgaaataattaga
aaaactcataacgattttgctcaaccatctgaaatacttgaacataaaatatcaaaaaaa
ttaaaaggagtagaaggacgtgcgtatcactttattagtatcattccatataatggtata
ttattattacttgatggacttagtgaaggaccaattattattgggggtgctgatgaaaat
tggcctataacaggaatgaaaccattttttgaaggacttattagtgctatgcaaggaagt
cttgaatttacattattagcagtggttcaagaccaaattaagaaatatcaagaattatat
gaaaatgctattgctgagaaaaatgaatatcaaatagaaatatataaagatattattgat
gaagaaaaaaaaattaaagaacaacaacacaaagaaaataaaagaagaaaacatgattat
atgccattagcattaaatttaattctatttcttggaaaacatcataaattagaacaagaa
gtagaaaaacaaataaatgaaataacaaagaagtaa

DBGET integrated database retrieval system