KEGG   Entamoeba dispar: EDI_204340Help
Entry
EDI_204340        CDS       T01083                                 

Definition
histone acetyltransferase GCN5 (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EDI_204340
Transcription machinery [BR:edi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     EDI_204340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MSDAPKVRGAIPREKEKKGEIKFITVANKGTREQLELLTAMKNIVSRHLPNMALDYISRI
VYDTVYHESLLLINCKDNKPFGGICFRPFPTQGFVEIVFCAVDSTQQVQGFGSYLMQHLK
KEIQSRGIYHILTYADNQAIGYFMKQGFHKHVTLNKERWQGYIKDYVEATLMECVLHKNV
EDYTDVPSTIKKQRDALQSLIGQVSKSEIRPGLTCFKQGIPKIKIEEIPGLKETGWKPDI
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgcaccaaaagttcgaggagcaattccaagggaaaaagaaaaaaaaggagaa
attaaattcattactgttgctaataaaggaacaagagaacaattagaattattaacagca
atgaaaaatattgtttcaagacatttacctaatatggcattggattatattagtagaatt
gtttatgatactgtatatcatgaatcgttgttacttattaattgtaaagacaataagccc
tttggtggaatttgttttagaccatttccaactcaagggtttgttgaaatagttttctgt
gctgttgattctacacaacaagtacaagggttcggttcatatctaatgcaacatttaaag
aaagaaattcaaagtcgaggaatttatcatatactaacttatgctgacaatcaggctatt
ggttattttatgaaacaaggttttcataagcatgtaacattaaataaagaacgttggcaa
ggttacattaaagattatgttgaagctacattaatggaatgtgttcttcataaaaatgta
gaagattatactgatgttccctcaacaatcaaaaaacaacgagatgcattacagtcttta
ataggacaagtatctaaatctgaaatacgtccaggattaacctgttttaaacaaggaatt
cctaaaataaaaattgaagaaatacctggattgaaagaaactggttggaagcctgatatt
cattaa

DBGET integrated database retrieval system