KEGG   Entamoeba dispar: EDI_213650Help
Entry
EDI_213650        CDS       T01083                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:2.4.1.11 3.1.2.15 2.7.7.47)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EDI_213650
Peptidases [BR:edi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EDI_213650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 891 aa AA seqDB search
MNLYSTNPFTEFYVAISHLQKEGKFPSNYMDEIQDGTTKKYFAVPVPFVKSIHDAAVAYS
SFHEEDKIEIEKLYKLPKLDTIMGLSDENGYLKGEIKEGIDYLLISKKNKKMIKRLYGFF
DEDIIFPKLPKVYIYKTQKYVIKESIPIHLTITLHFIGINQTESIIERTKEVYKNITISK
AIKNLQKEFQNDIKFINYEVKVMKNEEEEVENLENIVSTIIINSNELNKVNIQIIEKQTP
MINSIYSYASNISSRYSGYYGIRNEEEPNGIKGVCGLHNLGNTCYMNSAIQCLIHTIPLV
QFFQKEDWKKEININNPLGTSGKLVEQWYQLLIKYWSGYSTITPREFKYAIGEFAPQFSG
YQQHDSQELVAYLIDGIHEDLNRVLKKPYIETPDYNNEPDNEWAIAEWNRYKQRNDSIIT
DLFAAQLKSKVICDVCHNINMRFDPYVFLSLAIPNKQNSVSIYVCDKKYQNTKTIKLNIK
GKNIEEIIKESTKDICLNTNPNNFVIVQFGYEKKIERIIKDGKLEKDMEYGIIEKQDDES
DFIVYDCLIKYASYKQYRIPVVFGKSINKEIVDEKLFELFKDTYKSKLNEWEPKINISNK
KVHEEEEDNDDDDNEDDMNNNIKENQNNSILIFNNKKLENQHEEQKIEIDELKEKEEIKE
KKWNFEFKEENENIIQCQSIDNGVFKYLYDRGMSYHYNQTDGDPVTLEECFETFEAEELM
DENNKVYCSKCKEHQLSHKKVDLWSTNQILIIHLKRFGNSCGYSRDKITTFVDFPIESLD
LTRFVKHYDPTTPPIYNLYGVTNHMGSLGGGHYVASARVGKDWYDFNDSSTSKIEGTKEN
IVSKNAYVLYYIRKDIDQQISINTEEFIKDENNEIQKEVIQERGNGLMKEI
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtacagtacaaatcctttcacagaattttatgttgcaattagtcaccttcaa
aaagaaggaaaatttccatcaaactatatggatgagatacaagatggtacaacaaaaaag
tattttgcagtaccagtgccatttgtaaagagtattcatgatgctgcagttgcatatagt
tcatttcatgaagaagataaaatagaaattgaaaaattatacaaattacctaaattagat
acaataatgggattaagtgatgaaaatggatatcttaaaggagaaataaaagaaggaata
gattatttattaattagtaaaaagaataagaaaatgataaaaagattatatggatttttt
gatgaagatataatatttcctaaattacctaaagtttatatttataaaacacaaaaatat
gttatcaaagaaagtattccaatacatttaactattactcttcattttattggaattaac
caaacagaaagtataattgaacgtacaaaagaagtatataaaaatattacaatttcaaaa
gcaattaagaatttacaaaaagaatttcaaaatgatattaaatttataaattatgaagtt
aaagtaatgaaaaatgaagaagaagaagtagaaaatttagaaaatattgtatcaacaatt
attattaattcaaatgaattaaataaagttaatattcaaattattgaaaaacaaacacca
atgataaattcaatttattcatatgcatcaaatattagttcaagatattctggatattat
ggaattagaaatgaagaagaaccaaatggaataaaaggtgtttgtggattacataattta
ggaaatacatgttatatgaattctgctattcaatgtttaattcatacaattccattagtt
caattttttcaaaaagaagattggaaaaaagaaattaatataaataatccattaggaaca
tctggtaaattagttgaacaatggtatcaattattaataaaatattggtcaggttattct
actattactcctagagaatttaaatatgctattggagaatttgcaccacaatttagtgga
tatcaacaacatgattcacaagaattagtagcatatttaattgatggaatacatgaagat
ttaaatcgtgttttaaaaaaaccatatattgaaacacctgattataataatgaaccagat
aatgaatgggctatagctgaatggaatagatataaacaaagaaatgattcaattattaca
gatttatttgcagcacaacttaaaagtaaagttatttgtgatgtttgtcataatataaat
atgagatttgatccatatgtattcttatcacttgcaattccaaataaacaaaattcagta
tcaatttatgtttgtgataagaaatatcaaaatactaaaacaattaaacttaatattaaa
ggaaaaaatattgaagaaattattaaagaatcaacaaaagatatttgtttaaatacaaat
ccaaataattttgttattgtacaatttggatatgaaaaaaaaattgaaagaataataaaa
gatggtaaattagaaaaagatatggaatatggtattattgaaaaacaagatgatgaatca
gattttattgtttatgattgtttaataaaatatgcttcttataaacaatatagaatacca
gttgtatttggaaaatcaattaataaagaaattgttgatgaaaaattatttgaattattt
aaagatacttataaaagtaaattaaatgaatgggaaccaaaaataaatatttctaataaa
aaagttcatgaagaagaagaagataatgatgatgatgataatgaagatgatatgaataat
aatattaaagaaaatcaaaataatagtatattaatttttaataataaaaaattagaaaat
caacatgaagaacaaaaaattgaaattgatgaacttaaagaaaaagaagaaattaaagaa
aaaaaatggaattttgaatttaaagaagaaaatgaaaatattattcaatgtcaaagtatt
gataatggtgtatttaaatatttatatgatagaggaatgtcatatcattataatcaaaca
gatggtgatcctgttactcttgaagaatgttttgaaacatttgaagcagaagaattaatg
gatgaaaataataaagtttattgttctaaatgtaaagaacaccaattatcacataaaaaa
gttgatctttggagtactaatcaaatacttattattcatttaaaaagatttggtaatagt
tgtggttattctcgtgataaaattactacctttgttgattttccaattgaatcattagat
cttactagatttgttaaacattatgatccaacaacacctccaatttataatttatatggt
gttactaatcatatgggttctcttggtggtggacattatgtcgcatctgctcgtgttgga
aaggattggtatgattttaatgattcaagtacttcaaagattgaggggacaaaagaaaat
attgtttcaaagaatgcttatgtattgtattacattagaaaagatattgaccaacaaata
agtatcaatacagaagaatttataaaagacgaaaataatgaaattcaaaaagaagtaata
caagaaaggggtaatggattaatgaaagaaatttaa

DBGET integrated database retrieval system