KEGG   Entamoeba dispar: EDI_228510Help
Entry
EDI_228510        CDS       T01083                                 

Definition
nucleoporin-17 (EC:2.3.1.48)
Orthology
K14298  
mRNA export factor
Organism
edi  Entamoeba dispar
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EDI_228510
Messenger RNA biogenesis [BR:edi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     EDI_228510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MSKQQSNSPVFPLGEPKTFQDTISGIEGHSSQNGILIGVSSWDKTCKAFLVNSPTQTQIV
GSVNCNSPLTSICKVHESQFLVGSLNGGVYLWNVQQNSLQQVGQFNDCITSMKPLLETNS
IVISSLDGSLGLLDLNSGNISKMPVNNKVICMDAKYPYITFHTPNKVEVFNIQSGKLMTD
TLIGGQQSTINSSVQCIAVFPDRKGIVYGGADGRANVLHFENKSNQYTYAFKAQHKKIST
TQTYYYPVNSISFYNETIFLTAGSDGVINIWDKNKKSLVNTLTSPIQNCPITTADFICEN
KFLAYSVGYDWHQGVEGLLQQQVSVPVIKVVDDPLVRL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaacaatcaaattcaccagtttttccattaggagaaccaaaaacattccaa
gacaccattagtggtattgagggacacagttcacaaaatggaattttaattggagtatcg
tcatgggataaaacatgtaaagcatttttagttaattcaccaacacaaacacaaattgtt
ggaagtgttaattgtaactcaccactaacttctatatgtaaagttcatgaatcacaattt
ttagttggatcacttaatgggggagtatatttgtggaatgttcaacaaaattcactacaa
caagtaggacaattcaatgattgtataacttctatgaaaccacttcttgaaactaattct
attgttatttcgagtttagatggatcattaggactactcgatttgaattcaggtaatatt
tcaaaaatgccagtgaataataaagttatttgtatggatgctaaatacccttatattact
ttccatactccaaataaagtagaagtatttaatatacaatcaggtaagttaatgacagat
actcttattggagggcaacaatctactattaattcaagtgttcaatgtatagcagtattc
cctgatagaaagggtattgtatatggtggtgctgatggaagagcaaatgttcttcatttt
gaaaacaaaagtaaccaatatacttatgcatttaaagctcaacataaaaaaatatcaaca
actcaaacatactattatccagttaattcaatttcattttataatgaaacaatattcctt
actgctggtagtgatggtgttattaatatttgggataaaaataagaaaagccttgttaat
actttaacttctcctattcaaaattgtccaataactacagctgatttcatttgtgaaaat
aaatttttagcttattcagttggatatgattggcaccaaggagtagaaggacttcttcaa
caacaagtgtcagttccagtaatcaaagtagtggatgatcctttagttcgtttatga

DBGET integrated database retrieval system