KEGG   Entamoeba dispar: EDI_237980Help
Entry
EDI_237980        CDS       T01083                                 

Definition
clathrin heavy chain (EC:2.3.1.48)
Orthology
K04646  
clathrin heavy chain
Organism
edi  Entamoeba dispar
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:edi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    EDI_237980
Exosome [BR:edi04147]
 Exosomal proteins
  Proteins found in most exosomes
   EDI_237980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 1702 aa AA seqDB search
MAIRPPIQIKEVVRLDRFVKPESIGFTSVSIEGDKHFTVLEKGEEKRVRIFHNNKINSPD
SRSCGADFAIMHPTKQIMAVAAGTTVQMFDVQSKSKVADITLQTPLVFWKWANEHILAIV
TSTTVFHFDLNNPNIAPKKIVDRHSELAASQIIGYKIDPTEKWVAILALLQKNNEIIGKI
QLYSIEKNASQIIDGYAASFYNYKFDGASQASVMFAFAQKFPTPRLGLIEVIKGEVSKPN
VNTVIDIPIQPQQQADFMVGLVVSIKYETILLISRMGYIYGFYSGDGTLFFQGRVIDDII
FLTAYNQSTDGVTVVGKKGVVTNIYIEGDKLVPFICNGLKNVGLGCKVAARCNLPGADDI
FVERFNALLNAGQIREAALIAANSPGELIRNSNTINKLSQMQAQPGQNPPLFLYFATILE
TSSLNALEGFTLIQLLIPQNKLPAVEAWIVNDKIECSEKAGDLVKPYDQRLALMIYSKAH
ATGKVVQSLAEMGQSDKIVAYCERAGFSPDYLQILQQILPASGEAAKAYTTSLIQQKGYD
ELDMISIIDLFARYRYLKEITALILDTLDGDNEQYANIQTKILEMNLIGAPQIADTIFEN
DMLKHFDHNRIGKLCEQAGLFKRALQIFEEFDDIRRVLAHASAIPPELIIESFRKLEPEQ
AILVLQDLLRTNPRGNLQIIIKILLEFHTGLGDDKVIDLLQKFDCWEGLFYFLSQIVNTT
NDKMVVFKYIEACARSGQFQELARVVQENDVYDPNEVKEFLKNARIADQIPFIIVCDKHG
YVEEMTQYLYQNGNHRFIEAYVKKINPMNTPKVVGALLDCGCGEDYIQQLINAVGGICPA
DELIKTCESRNRLIILLPWLEQRLSEGSPDVSLHTALAKVYVDQGKDAEKFLNNDMYYDS
LIVGKYCEDRDPYLSYICYKRKNLDDELIDVTNRHNLFKYQAKYLVEREDLELWNKVLTE
ENEHRKSVVEQVIHTALPECIDPNQILKTVQAFLQNDLPNDLIDLLDKLVSQNPEYSTNP
TLQKLLIQTSIKAAPNRVMDYIRKLNDYDPKEIGESCIADNLFEEAYEVYTKFDLQEEAM
DVLLQYIKDLTRAKDFADKAKKDILYKKLGEAQLNEMKVKDAIISLMKAKDISLRSRVID
IAESDGSYEDLINYLLMCKEETKDMIVETELLYCYAKLKKNEEIENFLKTANCANLTSIA
ERCYNEELYGAAKILYTSLNNYIKLASCLLKLKDYAGAVEAAKKANSTRTWKEVTFACID
AKEFTLAQETGINILIAGDEITELVYYYEKNELYDQVIELLEAGLKIENVHVSMFTELAI
LYSKYKEEKLYDYLKQYITKIQCQKVIPTVNMNQQWKELVFLYVQVDQVKAIETMISYPD
NCFDHQLMKELLISVPRIDMIYKAESYYLAEKPEKINEMLIAVAHRCDHTQVISIARKEK
DLNTIREYLLYCLDLNNDSVNEALIDLFIDDGDAKSLKSLIEKNTNFNKIGLANRLKVHE
DIEFRKIAAYLYSSSDDYKSAIELCKKEGFDDDAMEIAKKSKDEEKVTDLLNFFVEQDKK
EAFGNCLNVCYDYVPTEVALELGYKNKLMDQTMPFMCKKMKDTNDRIKKLEQAEKDRQNA
KKEPQLAQQDTPFGMLALPAAPGMMPIQQPMGGMGMMNQPMQGMTPSIQPQTAMGGMGMM
NQPMQGMTPMGTTSTSNGEFIF
NT seq 5109 nt NT seq  +upstreamnt  +downstreamnt
atggctattagaccaccaattcaaataaaagaagtagttagattagacagatttgtcaaa
ccagaaagtattggatttaccagtgtttctattgaaggagataaacattttacagtatta
gaaaaaggagaagagaaaagagttagaatattccataataataaaattaatagtccagat
tcaagatcatgtggtgcagattttgctattatgcatccaacaaaacaaattatggcagtt
gctgcaggaactacagttcaaatgtttgatgttcaatctaaatctaaagtagcagatata
acacttcaaacaccattagtattttggaaatgggctaatgaacatattttagctattgta
acatcaacaacagtatttcattttgatttaaataatccaaatattgcaccaaagaaaatt
gttgatagacattcagaacttgcagcatcacaaattattggatataaaattgatccaaca
gaaaaatgggttgctattcttgcattattacaaaaaaataatgaaattattggaaaaatt
caattatattctattgaaaagaatgcatcacaaattatagatggatatgcagctagtttt
tataattataaatttgatggagcatcacaagcatcagttatgtttgcatttgcacaaaaa
ttcccaacaccaagacttggattaattgaagttattaaaggagaagtatctaaaccaaat
gtaaatacagtaattgatatacctattcaaccacaacaacaagcagattttatggtagga
ttagttgtttcaataaaatatgaaacaatattattaatatcaagaatgggatatatttat
ggattttattcaggagatggtacattatttttccaaggaagagtaattgatgatattatt
ttcttaactgcatataatcaaagtacagatggagtaacagttgtaggaaaaaaaggagtt
gtaactaatatttatattgaaggagataaattagttccatttatttgtaatggattaaaa
aatgttggacttggatgtaaagttgcagctagatgtaatcttccaggagctgatgatatt
tttgtagaaagatttaatgcacttttaaatgcaggacaaattagagaagcagctcttatt
gcagctaattcaccaggtgaattaattagaaattcaaatacaattaataaattaagtcaa
atgcaagcacaaccaggacaaaatccaccattattcctttattttgctactattttagaa
actagttcacttaatgcacttgaaggatttactcttattcaattacttattccacaaaat
aaacttccagcagttgaagcatggattgtaaatgataaaatagaatgtagtgaaaaagca
ggagatttagttaaaccatatgatcaaagacttgcattaatgatttattctaaagcacat
gctacaggaaaagtagttcaatcattagcagaaatgggacaaagtgataaaatagttgca
tattgtgaaagagcaggattttcaccagattatcttcaaattcttcaacaaattcttcca
gcatcaggagaagctgctaaagcatatactacaagtttaattcaacaaaaaggatatgat
gaattagatatgatttcaataatagatctttttgctagatatagatatcttaaagaaatt
actgcattaatacttgatactcttgatggagataatgaacaatatgctaatattcaaaca
aaaattcttgaaatgaatttaattggagcaccacaaattgctgatactatttttgagaat
gatatgttaaaacattttgatcataatagaattggtaaattatgtgaacaagctggatta
tttaaaagagcacttcaaatttttgaagaatttgatgatattagaagagttcttgcacac
gcatctgctattccaccagaattaattattgaaagttttagaaaattagaaccagaacaa
gcaattcttgttcttcaagatcttttaagaacaaatccaagaggaaatcttcaaattatt
attaaaatattacttgaattccatactggacttggagatgataaagtgattgatttactt
caaaaatttgattgttgggaaggattattttatttcttatctcaaattgttaatactact
aatgataaaatggttgtatttaaatatattgaagcatgtgctagatctggacaattccaa
gaattagcacgtgttgttcaagaaaatgatgtttatgatccaaatgaagttaaagaattc
ttaaaaaatgcaagaattgcagatcaaattccatttattattgtttgtgataaacatgga
tatgttgaagaaatgacacaatatctttatcaaaatggaaatcatagatttattgaagca
tatgttaaaaaaattaatccaatgaatactccaaaagttgttggtgcattattagattgt
ggatgtggagaagattatattcaacaattaattaatgcagttggaggtatttgtccagct
gatgaattaattaaaacatgtgaaagtagaaatagattaattatattattaccatggtta
gaacaaagattatctgaaggatctcctgatgtttctcttcatacagctcttgctaaagtt
tatgttgatcaaggaaaagatgcagagaaatttttaaataatgatatgtattatgattca
ttaattgtaggtaaatattgtgaagatagagatccatatttatcatatatttgttataag
agaaagaatttagatgatgaattaattgatgtaactaatagacataatttatttaaatat
caagcaaaatatcttgttgaaagagaagatcttgaattatggaataaagtattaacagaa
gaaaatgaacatagaaagagtgttgttgaacaagttattcatactgcacttccagaatgt
attgatccaaatcaaattcttaaaactgttcaagcattccttcaaaatgatcttccaaat
gatttgattgatttattagataaattagtttcacaaaatccagaatatagtactaatcca
acattacaaaaattattaattcaaactagtattaaagcagcaccaaatagagttatggat
tatattagaaaacttaatgattatgatccaaaagaaattggtgaaagttgtattgctgat
aatttatttgaagaagcatatgaagtttacactaaatttgatttacaagaagaagctatg
gatgtattattacaatatattaaagatcttactcgtgctaaagattttgctgataaagct
aaaaaagatattttatataaaaaacttggagaagcacaacttaatgaaatgaaagttaaa
gatgctattatttcattaatgaaagctaaagatattagtttaagatctagagtaattgat
attgcagaatcagatggatcatatgaagatttaattaattatttacttatgtgtaaagaa
gaaactaaagatatgatagttgaaacagaattattatattgttatgctaaattgaaaaag
aatgaagaaatagaaaatttccttaaaacagctaattgtgcaaatcttacatctattgca
gaaagatgttataatgaagaattatatggagctgctaaaattctttatacatcattaaat
aattatattaaattagcatcttgtttacttaaattaaaagattatgctggagctgtagaa
gctgctaaaaaagctaatagtactagaacatggaaagaagttacatttgcatgtattgat
gcaaaagaatttacattagcacaagaaacaggaattaatattttaattgctggagatgaa
attactgaattagtttattattatgaaaagaatgaattatatgatcaagttattgaatta
cttgaagcaggattaaaaattgaaaatgttcatgtttctatgtttactgaattagctatt
ctttattctaaatataaagaagaaaaattatatgattatcttaaacaatatattactaaa
attcaatgtcaaaaagttattccaacagttaatatgaatcaacaatggaaagaacttgta
ttcctttatgttcaagttgatcaagttaaagctattgaaactatgatttcatatccagat
aattgttttgatcatcaattaatgaaagaattattaattagtgttccaagaattgatatg
atttataaagctgaatcatattatcttgcagaaaaaccagaaaaaattaatgaaatgtta
attgctgtagctcatagatgtgatcatactcaagttatttctattgctcgtaaagaaaaa
gatcttaatactattcgagaatatcttctttattgtcttgacttaaataatgattcagtt
aatgaagcacttattgatcttttcattgatgatggtgatgctaagagcttaaagagtctt
attgaaaagaatacaaacttcaataaaattggattagctaatagattaaaagttcatgaa
gatattgaatttagaaaaattgctgcatatctttatagtagttctgatgattataagagt
gcaattgaattatgtaagaaagaaggatttgatgatgatgctatggaaattgctaaaaaa
tctaaagatgaagaaaaagttactgatttattaaatttctttgtagaacaagataagaaa
gaagcctttggaaattgtttgaatgtttgttatgattatgttccaacagaagtagcactt
gaacttggatataagaataaattaatggaccaaacaatgccatttatgtgtaagaaaatg
aaagatactaatgatagaattaaaaaacttgaacaagctgaaaaagatagacaaaatgct
aaaaaagaaccacaacttgctcaacaagatactccattcggtatgttagctcttcctgct
gcaccaggtatgatgccaatccaacaaccaatgggtggaatgggtatgatgaatcaacca
atgcaaggtatgactccttctattcaaccccaaactgctatgggtggaatgggtatgatg
aatcaaccaatgcaaggaatgactccaatgggaactacatcaacttcaaatggtgaattc
attttctaa

DBGET integrated database retrieval system