KEGG   Entamoeba dispar: EDI_254500Help
Entry
EDI_254500        CDS       T01083                                 

Definition
serine/threonine protein phosphatase PP1 (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
edi  Entamoeba dispar
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    EDI_254500
Enzymes [BR:edi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     EDI_254500
Protein phosphatases and associated proteins [BR:edi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     EDI_254500
Transcription machinery [BR:edi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     EDI_254500
Spliceosome [BR:edi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    EDI_254500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 262 aa AA seqDB search
MQDLSPERLDAIISKCFQERSLFPGKEFIKANEIKSLCSMAIRVIAQEPSLLQLKAPIYV
IGDLHGQFTDLLRYFDETKIDQDRYLFLGDYVDRGFRSIEIVVLVFALKVKYPDRFFLLR
GNHEAKNINHLYGFFDECKRRFDVDTWRNFCEVFRYLPVSALIEGKILCLHGGLSKDMQD
VSCLTQIARPTDIPEEGLLCDILWADPSTDTFGWEENMRGVSYTFGPDVALEFLKRNGIE
LLCRAHQVVEEGFKFFLIIVGQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacttatctccagaacgccttgatgcaatcatttcaaaatgtttccaagaaaga
tcattatttccaggaaaagaatttattaaagcaaatgaaataaaatcactatgttctatg
gcaattagagttattgcacaagaacctagtttacttcaattaaaagcaccgatatatgtt
attggagatttgcatggacaatttacggacttacttagatactttgatgaaacaaaaatt
gatcaagatagatatttatttcttggtgattatgtagatagaggatttcgatcaatagaa
attgttgtattagtatttgctttaaaagtaaaatatcctgatagatttttcttattacga
gggaatcatgaggcgaagaatattaaccatttatatggtttttttgatgaatgtaaaaga
agatttgatgttgatacatggagaaatttttgtgaagtttttagatatcttccagttagt
gcattaatcgaaggtaaaatactttgtttacatggagggttaagtaaagatatgcaagat
gtttcttgtttaacacaaattgcacgaccaactgatattccagaagaaggattattgtgt
gatattttatgggcagatccatcaactgatacttttggatgggaagaaaatatgagagga
gtatcatatacatttgggccagatgttgctttagaatttttaaaaagaaatggtattgaa
ttattatgtcgtgcacatcaagtagtagaagagggatttaaattttttttaataattgtg
gggcaatga

DBGET integrated database retrieval system