KEGG   Entamoeba dispar: EDI_265210Help
Entry
EDI_265210        CDS       T01083                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
edi  Entamoeba dispar
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1075 aa AA seqDB search
MTKEEDCKTVYEGICYSTPLPTRSFFYDESIGINTKRIKTIHLILTLCLNIGTDSPDQIK
QKDSASKECWIDTAGKTNRKLVYDIAANLTDQYRSWQNGSKIEPCCDPTYEDVRRLSLTF
RRMADTDRILFHYNGHGVPLPTLNGEIWFFDKEFTQYIPLQIYELLQTIGTPSIYIFDCN
CAGRIITWCKKYAQSKQKKNKNKNGENYMFLGSCQDDEMLPTNPFYPADLFTSCLTTPLR
VAVLYYIQNSLLMKWDPTIIDRIPGVLNNRRTPLGELNWIFTAITDSIAWNVLPRPLFYK
LFRQDLLIASLYRNFFLAQRVMQSLKCKPISYPILPDASNHYLWVVWDRALELCLLQINN
HCNSFNESTSSFFDEQLVAFEVWLESDNIANCIAAQLPILLQVLLSQTLRERALKLLCRF
LDLGPWACDQALAVGIFPYILKLLSSTTSVDFYEYLVFCWMKILVVDKKKTFHQNLIREN
HQIYFLNVLKNNTKNINTGTNAYALFILTTLLEDNTQVKTTLIQTNILEVINFYFKSENI
EVRSWALLCLSKLWEGTIEIKIRAQKKGIINSLILLLQDPNPRVRVALLNCLTTLIGEPY
TDNGEICNSITLKTAVLVHDACPKVREHLIVLYQRLAKILVGTVKESKIFEQTVEIGIED
PDTDVNGAAEILNEILEIYTNKNEERRSISPKRKITVLNTIVNKLYESRVYELSQPLLKK
RIEITPQRKWFKEKYVESRTQFTLIGSDFENHKLKQIGRFITEEEHEFNPGIMIFHPTLP
LLVVGSNKGSIIKVFDTNNESVVNTWNNLNLGNKSISGMTWINRTDIPMLVTSTNDGAIR
IWRNWDDSGSNVLVSSFKGVMEECLPDIGAKVVGLGETRLLTAGNSIIRIWDLEKEELEA
NIRIKSSITCVNEYNEFSDHMFLVGNINGKVNLYDMRLSPQEREVKTWKISHSPIITTSR
PSSGNTIIAGAVARFNEPSLAALIDIRASQIRNLYVPKLTTLVTHPTATYFLCGSAEQFI
RSYNSESGKMIQEIKYYDGFFGHRINPVVNMAITQFGFNTAVSSTDSSITLFGFD
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagaagaagattgtaaaacagtgtatgaagggatatgttatagtacaccactt
ccaacaagatcatttttttatgacgaaagtataggaataaatactaaacgaataaaaacg
attcatttaatacttacattatgtttaaatataggaactgattcaccagaccaaattaaa
caaaaagattcagcatcaaaagaatgttggatagatacagcagggaaaacaaatcgaaaa
ttagtgtatgatatagcagcgaatcttacagatcaatatcgatcatggcaaaatggaagt
aaaattgaaccatgttgtgatccaacatatgaagatgtaagaagattaagtttaacattt
agaagaatggcagatacggatagaatattatttcattataatggacatggagtaccatta
ccaacattaaatggagagatatggttttttgataaagaatttacacaatatattccactt
caaatatatgaattattacaaacaataggaacaccaagtatatatatatttgattgtaat
tgtgcaggaagaattataacatggtgtaaaaaatatgcacaaagtaaacaaaaaaagaat
aaaaataaaaatggagaaaattatatgtttcttggatcatgtcaagatgatgaaatgtta
ccaacaaatccattttatccagctgatttatttacatcatgtttaacaacaccattaaga
gtagcagtattatattatattcaaaattcattattaatgaaatgggatccaacaataata
gatagaattccaggagtattaaataatagaagaacaccattaggagaattaaattggata
tttacagcaataacagattcaatagcatggaatgtattaccaagaccattattttataaa
ttatttcgacaagatttattaatagcatcattatatagaaattttttcttagcacaaaga
gtaatgcaatcattaaaatgtaaacctatatcatatccaattttaccagatgcatcaaat
cattatttatgggtagtttgggatagagcacttgaattatgtttacttcaaattaataat
cattgtaatagttttaatgaaagtacatcatcattttttgatgaacaattagttgcattt
gaagtatggttagaatcagataatatagctaattgtattgcagcgcaacttccaatttta
ttacaagtattattatcacaaacattaagagaaagagcattaaaattattatgtagattt
ttagatttaggaccatgggcatgtgatcaagcattagcagtaggaatatttccatatata
ttaaaattattaagttctacaacaagtgtagatttttatgaatatttagtattttgttgg
atgaaaatattagttgttgataaaaagaaaacatttcatcaaaatcttattagagaaaat
catcaaatatattttttaaatgtattaaaaaataatacaaaaaatataaatacaggaaca
aatgcatatgcattatttattttaactacattattagaagataatacacaagttaaaaca
acattaatacaaacaaatatattagaagtaattaatttttattttaaaagtgaaaatata
gaagtaagatcatgggcattattatgtttaagtaaattatgggaaggaacaattgaaatt
aaaataagagcacaaaaaaaaggaattattaattcattaatattacttttacaagatcca
aatccaagagtaagagtagcattattaaattgtttaactacattaattggagaaccatat
acagataatggagaaatttgtaatagtattacattaaaaacagcagttttagttcatgat
gcatgtcctaaagtaagagaacatttaatagttttatatcaaagattagcaaaaatttta
gttggaacagttaaagaatctaaaatatttgaacaaacagtagaaataggaatagaagat
ccagatactgatgtaaatggagcagcagaaatattaaatgaaatattagaaatatataca
aataaaaatgaagaaagaagatcaatatcaccaaaaagaaaaattacagtattaaataca
attgtaaataaattatatgaatcaagagtttatgaattatcacaaccattattaaaaaaa
agaatagaaataacaccacaaagaaaatggtttaaagaaaaatatgttgaaagtagaaca
caatttacacttattggaagtgattttgaaaatcataaattaaaacaaataggtagattt
attacagaagaagaacatgaatttaatccaggaattatgatatttcatccaacattacca
ttattagtagtaggaagtaataaaggatcaataataaaagtatttgatacaaataatgaa
agtgttgtaaatacatggaataatttaaatttaggaaataaaagtataagtggaatgaca
tggataaatagaactgatattccaatgttagttacatcaactaatgatggagcaataaga
atttggagaaattgggatgatagtggaagtaatgttcttgtaagtagttttaaaggtgta
atggaagaatgtttaccagatattggagcaaaagtagttggattaggtgaaactagatta
ttaacagcaggaaattcaataataagaatatgggatttagaaaaagaagaattagaagca
aatattagaattaaatcatcaattacttgtgtaaatgaatataatgaatttagtgatcat
atgtttcttgtaggtaatattaatggaaaagtaaatttatatgatatgagattatctcct
caagaaagagaagtaaaaacttggaaaatttctcattctccaattattactacttcaaga
ccaagttctggaaatacaattattgctggtgctgttgctagatttaatgaaccttcttta
gctgctttaattgatattcgtgctagtcaaattagaaacctgtatgtccctaaacttact
actttagtaactcatcctactgctacttatttcctttgtggaagtgctgaacaattcatt
agatcttataatagtgaatcgggtaaaatgattcaagaaattaaatattatgatggtttc
tttggtcatagaattaatcccgtagttaatatggctatcactcaatttggttttaatact
gctgtttcttctactgattcaagtattactttatttggtttcgattaa

DBGET integrated database retrieval system