KEGG   Entamoeba dispar: EDI_270260Help
Entry
EDI_270260        CDS       T01083                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 1A (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
edi  Entamoeba dispar
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 413 aa AA seqDB search
MSCISQVQKPLTLLLTHEIQNTYLYCKEQKKNIQNKAKTRIDKDGHLLWRINEVLANRYQ
LIKGLGKGSFGQVIQSIDLVTGEQVALKVIRKDKNFYEQAKLEVQILYLLNTNDRADQFK
IVRLKDTFNLSGHFCMVFELLSYNLYDFLMKKNGSLGLSLVRRFAFQILSALNFLQQPGI
RVIHCDLKPENIVLVSPDKANIKIIDFGSSCTPSTHMYKYIQSRYYRSPEVVMGLPYSHP
IDMWSLGCILPELLTTEPLFPARSEVELLVMMGALLGMPPNSMIKESHRARKLFIPHEND
ENYDFHPTLQPLYNKKKKLRNIIGVDIGGPLTRTPGERMERDELEKFCDLCLKMLSFDPS
KRITPNEALAHPFFQSGITKEINPLRKKEEKKMEEEPLVNVETGNDSGRPMSR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtatttcacaagtacaaaaacctttaacattactccttactcatgaaattcaa
aatacatatttgtactgtaaagaacaaaagaaaaatatacaaaataaagctaaaacaaga
atagataaagatggacatttactttggagaattaatgaagtattagcgaatagataccaa
ttaataaaaggacttggaaaaggttcatttggacaagtaattcaatctattgatttagta
acaggagaacaagttgctttaaaagtaataagaaaagataaaaatttttatgaacaagcg
aaattagaagttcaaatattatatttattaaatactaatgatcgagcagaccaattcaaa
attgttcgtttaaaagatacattcaatttaagtggtcatttttgtatggtatttgaatta
ctttcatacaacttatatgattttttaatgaaaaaaaatggttcattgggattatcatta
gtaagaagatttgcatttcaaatattaagtgcattaaattttttacaacaacctggtatt
agagtaattcattgtgacttaaaacctgaaaatattgttttagtatcaccagataaagct
aatattaaaattattgattttggttcttcatgtactccatctactcatatgtacaaatat
atccaatctagatattatcgttcacctgaagtagttatgggtttaccttattctcatcca
atagatatgtggtctttaggttgtattttaccagaattacttacaaccgaacctttattt
ccagctcgttctgaagttgaattacttgtaatgatgggggcattacttggaatgcctcct
aattcaatgataaaagaaagtcatcgtgcaagaaaattatttattcctcatgaaaatgat
gaaaattatgatttccatccgactcttcaacctctttataataagaaaaagaaattaaga
aatatcattggtgttgatattggtggtcctttaacaagaactccaggtgaacgaatggaa
agagatgaacttgaaaagttttgtgatttatgtcttaaaatgctttcttttgatcctagt
aaaagaatcactcctaatgaagctcttgctcatccattctttcaaagtggtattactaag
gaaatcaatcctttacgtaaaaaagaagaaaagaaaatggaagaagaaccacttgttaat
gttgaaactgggaatgatagtggtaggccaatgtcaagataa

DBGET integrated database retrieval system