KEGG   Entamoeba dispar: EDI_270260Help
Entry
EDI_270260        CDS       T01083                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 1A (EC:2.7.12.1)
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     EDI_270260
Protein kinases [BR:edi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   EDI_270260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
MSCISQVQKPLTLLLTHEIQNTYLYCKEQKKNIQNKAKTRIDKDGHLLWRINEVLANRYQ
LIKGLGKGSFGQVIQSIDLVTGEQVALKVIRKDKNFYEQAKLEVQILYLLNTNDRADQFK
IVRLKDTFNLSGHFCMVFELLSYNLYDFLMKKNGSLGLSLVRRFAFQILSALNFLQQPGI
RVIHCDLKPENIVLVSPDKANIKIIDFGSSCTPSTHMYKYIQSRYYRSPEVVMGLPYSHP
IDMWSLGCILPELLTTEPLFPARSEVELLVMMGALLGMPPNSMIKESHRARKLFIPHEND
ENYDFHPTLQPLYNKKKKLRNIIGVDIGGPLTRTPGERMERDELEKFCDLCLKMLSFDPS
KRITPNEALAHPFFQSGITKEINPLRKKEEKKMEEEPLVNVETGNDSGRPMSR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtatttcacaagtacaaaaacctttaacattactccttactcatgaaattcaa
aatacatatttgtactgtaaagaacaaaagaaaaatatacaaaataaagctaaaacaaga
atagataaagatggacatttactttggagaattaatgaagtattagcgaatagataccaa
ttaataaaaggacttggaaaaggttcatttggacaagtaattcaatctattgatttagta
acaggagaacaagttgctttaaaagtaataagaaaagataaaaatttttatgaacaagcg
aaattagaagttcaaatattatatttattaaatactaatgatcgagcagaccaattcaaa
attgttcgtttaaaagatacattcaatttaagtggtcatttttgtatggtatttgaatta
ctttcatacaacttatatgattttttaatgaaaaaaaatggttcattgggattatcatta
gtaagaagatttgcatttcaaatattaagtgcattaaattttttacaacaacctggtatt
agagtaattcattgtgacttaaaacctgaaaatattgttttagtatcaccagataaagct
aatattaaaattattgattttggttcttcatgtactccatctactcatatgtacaaatat
atccaatctagatattatcgttcacctgaagtagttatgggtttaccttattctcatcca
atagatatgtggtctttaggttgtattttaccagaattacttacaaccgaacctttattt
ccagctcgttctgaagttgaattacttgtaatgatgggggcattacttggaatgcctcct
aattcaatgataaaagaaagtcatcgtgcaagaaaattatttattcctcatgaaaatgat
gaaaattatgatttccatccgactcttcaacctctttataataagaaaaagaaattaaga
aatatcattggtgttgatattggtggtcctttaacaagaactccaggtgaacgaatggaa
agagatgaacttgaaaagttttgtgatttatgtcttaaaatgctttcttttgatcctagt
aaaagaatcactcctaatgaagctcttgctcatccattctttcaaagtggtattactaag
gaaatcaatcctttacgtaaaaaagaagaaaagaaaatggaagaagaaccacttgttaat
gttgaaactgggaatgatagtggtaggccaatgtcaagataa

DBGET integrated database retrieval system