KEGG   Entamoeba dispar: EDI_280110Help
Entry
EDI_280110        CDS       T01083                                 

Definition
centromeric protein E
Organism
edi  Entamoeba dispar
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 2983 aa AA seqDB search
MNDKNKIKQEKKEESKEIIKEYIEEFNKNLYELSIKENFFKEEKDLEIVEDFCIEVEDIN
KQEEEKEKKKRIINMIGIIMYQMRKSLYEWAHLRTYFIIERIKKVMKIFIHFIIKYMEEN
IKNKEINKEDIQKITIIFKIGMEEKIEKEYEDIIKIFSVKEFYNEMSSEGIIKLKEKRNK
EEIKEDNKNILDKQIMKGLLNIDVTKTINKELEEKDIYGKIIEENQRIFNYEEKGIGKYF
EYITIPIDSISERIKNNKEKNINNQNDIQKINKEIKEILIFIMNTFPKIEPTCIGYISKV
LVKITEIHDLLSEINYHDECENLVSIIYSIINIIGENIGNIVVETNMQAYCAAHLFQTLL
PNNFSLKEFLKSLNNTNESIDMPCLYPMAVALTFSREVFQKISNNKKFIVDESSYKNVSS
IPLKLKMYDVEFDALTLQNNSVLSTIILSPGGKFLDIIFSLLLMSFLGIGYLEQELLREK
KIFIKKEEEIKEKENKINKQKKIIGKLDISITNKENNKSNAFLKTPRNKTPRNTLTPRKS
ILTPRKEENKEIKEIKDKKIKIEEIKKKEENNKEINYDITRSLPLYLSIFIFGESSNEEL
RKYVSKYFNAYHLDVIIFLTQIESNNININSQEKIYGPLVKDKESIMNLRSLCSSLVNYN
WLSEQLMGYIIRKQNKEYPIQVPNELIIFLTRVWINRITNKKEGDKEDMQGINLWETMNK
NIEKIIKEKEWKKGEVISQEYMIMMLLIYNSFKEENKKKFIIQIFNNIINIEINKEINKI
ILSRLCMMLKYMIEHFKENGNEIIESIQKNILTKDIIINKSENIIYPNYMKYNQEVLKEI
KKKIEGTEYQNIEFYSLNQENKYQDMINKIRRGLLENNEKNGEIIQNILSKEEYCIFINK
LLQFLQINKIITNEIEEMINEYLYHNIIELLTILPPSNNIIEKFQNKQIFSDNGINDGLI
ILIMWMNLFSYDINPIPKEIEDNAKELFKDLINILDKIGNIKEERKDQGIHYESIIKIII
DTIKSHCWNDIMIKSRIKEMEEEVEDKENIQINEELLKRKKVIIKIKEEEENTNNNLTQR
EILKKEINSINEIMYKEEEEEKEKIKEEEIVNNNNKIRIIDNLPILPIQSFSEACNEICI
KKPQILFDIITKILQKYSEMMKKGWREYIEEKGINKEYSQIFIDIMYKGIDLNSIEHIIE
EMYSTPKEINEKKNIIKEIGTQKGIKMKEFIHPLNYLIESIEYHPNITSKQGKIGMKQSL
IESIIILIKEICERNNINGNYQDSKIMKEIFKLSISYINKFIEKEIIEVGKKLCGDTLSE
PMMKQAILPIIDDFLEDFLIEYQNKKEEYKIIIPNIREYFKEMKKIIEDIEIQKQHGKVG
GEMYYYQHKNYYREPNLIIYFKCASEIIDKEVNEEIMKYIIKLCNVNNSIKDEIETIIEG
NGKEIFSKWGIQNIIGFNDNDNIFRIAESSTTIQFFKFINTIMKINAITGQVNVNGVIEA
FSQGIEEVFKKYPNYIGKYFKIITEYSLENGEFIIILNSLNNWLEKINKEYKEFNYKEIE
GISSLFEEIQHIIMIIPKKEKKNEIKNLIKKEEEEGNDEIIKIEDKCSKKEYKEEFKQPM
YHCYVCDINCCNSCIKNCHEGHDTIYLGEITSICECKCKEEEEEKKKDKKRNNDEGIKDK
KQQAILRALNRDYTIPKLIKELIKRIEETKEHYKEEKDKNQNILKNKIMLQNEGIGIGYE
ENILIDNNHFKMKSSQNMRIIPMVSKGIIKQNLICCDEERIYYVRKGNEIEINNIQKLLS
LKRNENNEENNIIEVPFEIINMSCCPEENKKILVNGYRNAEIIIIGENEEEQQIELVMDN
TDKDIFINCIEWIDKERIAITTRNSIKIFEINKINENNSSIIESSIDYKILQGEILSSVI
IKTPIIKRIIISTTESELFYQDIPKSFNENNKEEIIQKEFKINHEKELFIIKYLERENIL
ILSKETLESYLIELNNKGEIYNEVETIFETLPTYFIETSKNTMISNCQENKSIKSYKIMN
NGLNYIKLYEKEEIGGICYSNKEKIIFIGICNGNLIGLKETEEIEKINKLKPMRSNKQRF
FEKIEYIKPEDYEIKEDNKKIIIPEGKIQLYHCNIQCTKKVIRGIKIYFGKKVPKQINFK
ERNYPIGEGERWYDIELRKKESLLNNINISYCSTINEEDNISIEDIEIYGESKEEFNYEE
RKIIEEMKKEDNKEGKENNIFEECIKKGIEIIGIIYNITRSNKDRDEYKEDIINKVKEIY
NKGYKGINKACQDTLKLLSVNEQTEQKIIEKFKEINEKMINSNDNKEWNKYLLFIYDNQN
KKPNILLKYLISNPRFITNFCNNVIDKYNELKPSIISILIKILLRNIEIIEISKNHYKQH
FEIIKTIILLPQQLSEIALITICQYFTEKKPRIKEIEYTIRSIIQENKIIAVEKQIEIKG
GEIEFEYVKNIKETLNVMVNNKNKGKEEKLQTITETKEMSINKIIDEREPIEMNEMIYGI
INGILEIMNQIKEKSNVFGMMGVIFYWIITQKNYIIKEEYIDNLIDKMIEIIKENNEENS
FIIIKLISCLLSSLDIEYYQQYTRNELTNIIYSFKQGILPKPSVSLSRIIAKSIIKNKNG
IEHELYQLFNKEYNKIINGKLKIQIKGEKGNIHRKPISENNESMFDDIEIKIIENIMSII
YYLFNYKRDMEIKEIDDKEIWNKQIRELVNKNEFHTISYSCKRVLYQFGGGAYAFHLKTD
SEMYQHSIPKIIEIMNQLIKKQEIQNENEFKEEIYKIIRTSFKRPNLFQQYIREDNEIFL
LMIELLSMNLHNDIIVLLLKLLRSSFLINVDKTIREKPIKYGITQLQTIIEERQKVLDDL
EKNKDSERIFVESICKDSHILHNIILSLLQLNDKLINIELTKLIESIGNLANQYQRNTLL
NILWDCYPQFNTNSTLLSMISTISFLKAQGTLKIDHSINQYLN
NT seq 8952 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaaaataagataaaacaagaaaaaaaagaagagagtaaagaaattattaaa
gaatatattgaagaatttaataaaaatttatatgaattaagtataaaagaaaattttttt
aaagaagaaaaagatttagaaatagtagaagatttttgtattgaagtagaagatattaat
aaacaggaagaagaaaaagagaaaaagaagagaataataaatatgataggaattataatg
tatcaaatgagaaaaagtttatatgaatgggcacatttaagaacatattttataatagaa
agaataaaaaaagttatgaaaatatttattcattttattattaaatatatggaagagaat
attaaaaataaagaaataaataaagaagatatacaaaaaattacaattatatttaaaatt
ggaatggaagaaaaaattgaaaaagaatatgaagatataataaaaatatttagtgttaaa
gaattttataatgaaatgagtagtgaaggaataattaaattaaaagaaaaaagaaataaa
gaagaaataaaagaagataataaaaatatattagataaacaaataatgaaaggattatta
aatattgatgttactaaaacaataaataaagaattagaagaaaaagatatttatggaaaa
attatagaagagaatcaaagaatatttaattatgaagaaaaaggaataggaaaatatttt
gaatatattactattccaattgatagtattagtgaaagaattaaaaataataaagaaaaa
aatataaataatcaaaatgatattcaaaaaattaataaagaaattaaagaaatattaata
tttattatgaatacatttcctaaaattgaaccaacttgtattggatatattagtaaagta
ttagttaaaattacagaaattcatgatttattaagtgaaattaattatcatgatgaatgt
gaaaatttagttagtattatttattctattataaatattattggagaaaatattggtaat
attgttgttgaaacaaacatgcaagcttattgtgctgctcatctttttcaaacattatta
ccaaataatttttcattaaaagaatttttaaaaagtttaaataatacaaatgaatctatt
gatatgccttgtttatatccaatggctgttgctttaacattttcaagagaagtttttcaa
aaaatatcaaataataaaaaatttattgttgatgaaagttcatataaaaatgtttcaagt
attcctttaaaacttaaaatgtatgatgttgaatttgatgcattaacattacaaaataac
tcagtattatctacaattattctttcaccaggaggaaaatttttagatattatcttttca
ttattgttaatgagtttcttaggaattggatatcttgaacaagaattattaagagaaaag
aaaatttttataaaaaaagaagaagaaataaaagaaaaagaaaataaaataaataaacaa
aagaaaattattggaaaattagatatttctattacaaataaagaaaataataaatcaaat
gcattcttaaaaacacctagaaataaaacacctagaaatacattaacacctagaaaaagt
attttaacaccaagaaaagaagaaaataaagaaattaaagaaattaaagataaaaaaatt
aaaatagaagaaataaaaaagaaagaagaaaataataaagaaattaattatgatattact
agatcattaccactttatctttcaatattcatttttggagaaagttcaaatgaagaatta
agaaaatatgtttcaaaatattttaatgcatatcatcttgatgttattatctttttaact
caaatagaatctaataatattaatattaattcacaagaaaaaatatatggaccattagtt
aaagataaagaaagtataatgaatcttagatcattatgtagttcattagttaattataat
tggctttcagaacaattaatgggatatattattagaaaacaaaataaagaatatccaatt
caagtaccaaatgaattaataatttttttaacaagagtttggattaatagaattacaaat
aaaaaagaaggagataaagaagatatgcaaggaattaatttatgggaaacaatgaataaa
aatatagaaaaaatcataaaagaaaaagaatggaagaaaggagaagttataagtcaagaa
tatatgattatgatgttacttatttataattcatttaaagaagaaaataaaaagaaattt
attatacagatttttaataatattattaatattgaaataaataaagaaattaataaaatt
attttaagtagattatgtatgatgttaaaatatatgattgaacattttaaagaaaatgga
aatgaaattattgaaagtattcaaaaaaatattttaactaaagatattattattaataaa
tcagaaaatatcatttatccaaattatatgaaatataatcaagaagttcttaaagaaatt
aaaaaaaaaattgaaggaacagaatatcaaaatattgaattttatagtcttaatcaagaa
aataaatatcaagatatgattaataaaataagaagaggattattagaaaataatgaaaag
aatggagaaattattcagaatattttaagtaaagaagaatattgtatttttattaataaa
ttacttcaatttttacaaataaataaaataattacaaatgaaatagaagaaatgattaat
gaatatttatatcataatattattgaattattaactattttaccaccaagtaataatata
attgaaaaatttcaaaataaacaaatatttagtgataatggaattaatgatggattaatt
atattaattatgtggatgaatttatttagttatgatattaatcctattccaaaagaaatt
gaagataatgctaaagaattatttaaagatttaataaatattttagataaaattggaaat
attaaagaagaaagaaaagatcaaggaattcattatgaaagtataattaaaattattatt
gatacaattaaaagtcattgttggaatgatattatgattaaatcaagaattaaagaaatg
gaagaagaagttgaagataaagaaaatattcaaattaatgaagaattattaaaaagaaaa
aaagtaataattaaaattaaagaagaagaagaaaatacaaataataatttaacacaaaga
gaaattttaaaaaaagaaattaatagtattaatgaaataatgtataaagaagaagaagaa
gaaaaagaaaaaataaaagaagaagaaattgttaataataataataaaataagaattatt
gataatcttcctatattaccaattcaaagttttagtgaagcatgtaatgaaatatgtatt
aaaaaaccacaaattttatttgatattattacaaaaattcttcaaaaatatagtgaaatg
atgaaaaaaggatggagagaatatattgaagaaaaaggaataaataaagaatatagtcaa
atttttattgatattatgtataaaggaattgatttaaatagtattgaacatattattgaa
gaaatgtattcaacaccaaaagaaattaatgaaaagaaaaatattattaaagaaattgga
acacaaaaaggaattaaaatgaaagaatttattcatccattaaattatttaattgaaagt
attgaatatcatccaaatattactagtaaacaaggaaaaattggaatgaaacaaagttta
atagaaagtattattattttaataaaagaaatatgtgaaagaaataatattaatggaaat
tatcaagatagtaaaattatgaaagaaatttttaaattatcaattagttatattaataaa
tttattgaaaaagaaataatagaagttggaaaaaaactttgtggagatactttaagtgaa
ccaatgatgaaacaagcaatattaccaattattgatgattttttagaagattttttaata
gaatatcaaaataaaaaagaagaatataaaattattattccaaatattagagaatatttt
aaagaaatgaaaaaaattattgaagatattgaaattcaaaaacaacatggaaaagttgga
ggtgaaatgtattattatcaacataaaaattattatagagaaccaaatttaatcatatat
tttaaatgtgctagtgaaattatagataaagaagttaatgaagaaattatgaaatatatt
attaaattatgtaatgtaaataattctattaaagatgaaattgaaacaattattgaagga
aatggaaaagaaatattttcaaaatggggtattcaaaatattattggatttaatgataat
gataatatctttagaattgctgaaagttctactacaattcaattttttaaatttattaat
acaattatgaaaattaatgctattactggacaagttaatgttaatggagttattgaagca
ttttcacaaggaattgaagaagtatttaagaaatatccaaattatattggaaaatatttt
aaaataattacagaatattcattagaaaatggagaatttattattattcttaattcatta
aataattggttagaaaaaataaataaagaatataaagaatttaattataaagaaatagaa
ggtatttcatcattatttgaagaaatccaacatattattatgattattccaaagaaagaa
aaaaagaatgaaataaaaaatcttattaaaaaagaagaagaagaaggaaatgatgaaata
attaaaatagaagataaatgtagtaaaaaagaatataaagaagaatttaaacaaccaatg
tatcattgttatgtttgtgatattaattgttgtaattcatgtattaaaaattgtcatgaa
ggacatgatactatttatcttggtgaaataactagtatttgtgaatgtaaatgtaaagaa
gaagaagaagaaaaaaagaaagataaaaaacgtaataatgatgaaggaattaaagataaa
aaacaacaagctattctaagagcattaaatagagattatacaatacctaaattaattaaa
gaattaattaaaagaattgaagaaacaaaagaacattacaaagaagaaaaagataaaaat
caaaatattttaaaaaataaaattatgttacaaaatgaaggaattggtattggatatgaa
gaaaatatacttattgataataaccattttaaaatgaaaagtagtcaaaatatgagaatt
ataccaatggtgtctaaaggaattattaaacaaaatttaatatgttgtgatgaagaaaga
atttattatgtaagaaaaggaaatgaaattgaaattaataatattcaaaaacttctttca
ttaaaaagaaatgaaaataatgaagaaaataatattattgaagttccatttgaaattatt
aatatgagttgttgtccagaagaaaataaaaaaatattagttaatggatatagaaatgca
gaaattattattattggagaaaatgaagaagaacaacaaattgaattagttatggataat
acagataaagatatttttattaattgtattgaatggatagataaagaacgtattgcaatt
acaacaagaaattcaattaaaatatttgaaattaataaaattaatgaaaataatagttca
attattgaatcaagtattgattataaaattttacaaggagaaattttatcaagtgttatt
attaaaacaccaattataaaaagaattattattagtactactgaatcagaattattttat
caagatattcctaaatcatttaatgaaaataataaagaagaaattattcaaaaagaattt
aaaataaatcatgaaaaagaattatttataataaaatatttagaaagagaaaatatttta
atattaagtaaagaaacattagaaagttatttaattgaattaaataataaaggagaaatt
tataatgaagtagaaacaatatttgaaacattaccaacatattttattgaaacaagtaaa
aatacaatgattagtaattgtcaagaaaataaaagtattaaatcatataaaattatgaat
aatggattaaattatattaaattatatgaaaaagaagaaattggaggaatttgttatagt
aataaagaaaaaataatatttattggaatttgtaatggaaatcttattggattaaaagaa
accgaagaaattgaaaaaattaataaattaaaaccaatgagatcaaataaacaaagattt
tttgaaaaaatagaatatattaaaccagaagattatgaaataaaagaagataataaaaaa
attattattccagaaggtaaaattcaattatatcattgtaatattcaatgtacaaaaaaa
gtcattcgaggaattaaaatttattttggaaaaaaagtaccaaaacaaattaattttaaa
gaaagaaattatccaattggagaaggagaaagatggtatgatattgaattaagaaaaaaa
gaatcacttttaaataatattaatattagttattgttctacaattaatgaagaagataat
atttcaattgaagatatagaaatttatggagaaagtaaagaagaatttaattatgaagaa
agaaaaataattgaagaaatgaaaaaagaagataataaagaaggaaaagaaaataatatt
tttgaagaatgtattaaaaaaggaattgaaattattggaataatttataatatcactaga
agtaataaagatagagatgaatataaagaagatattattaataaagttaaagaaatttat
aataaaggatataaaggaattaataaagcatgtcaagatacattaaaattactttcagtt
aatgaacaaacagaacaaaaaattatagaaaaatttaaagaaattaatgaaaaaatgatt
aattcaaatgataataaagaatggaataaatatttattatttatttatgataatcaaaat
aaaaaacctaatattcttttaaaatatcttattagtaatcctagatttattactaatttt
tgtaataatgttattgataaatataatgaattaaaaccaagtattattagtattcttatt
aaaattttattaagaaatattgaaattattgaaatttcaaaaaatcattataaacaacat
tttgaaattattaaaacaattattttattacctcaacaattatctgaaatagcattaatt
acaatttgtcaatattttacagaaaaaaaaccaagaataaaagaaattgaatatactatt
agaagtattattcaagaaaataaaattattgctgtagaaaaacaaattgaaattaaagga
ggagaaatagaatttgaatatgttaaaaatattaaagaaacattaaatgtaatggtaaat
aataaaaataaaggaaaagaagaaaaattacaaacaattacagaaacaaaagaaatgtca
attaataaaattattgatgaaagagaaccaatagaaatgaatgaaatgatttatggaatt
attaatggtattttagaaataatgaatcaaattaaagaaaaaagtaatgtatttggaatg
atgggagttatattttattggattataactcaaaaaaattatattataaaagaagaatat
attgataatttaattgataaaatgatagaaataattaaagaaaataatgaagaaaattct
tttattattattaaattaataagttgtttattaagttcattagatattgaatattatcaa
caatatactagaaatgaattaactaatattatttattcatttaaacaaggtattttacct
aaaccatcagtttcattatcaagaataattgctaaatcaattattaaaaataaaaatgga
atagaacatgaactttatcaattatttaataaagaatataataaaattattaatggtaaa
ttaaaaattcaaattaaaggagaaaaaggaaatattcatagaaaaccaattagtgaaaat
aatgaatcaatgtttgatgatattgaaataaaaattattgaaaatattatgtcaattatt
tattatttatttaattataaaagagatatggaaattaaagaaattgatgataaagaaatt
tggaataaacaaataagagaattagtaaataaaaatgaatttcatactatttcatattca
tgtaaaagagtattatatcaatttggtggtggtgcttatgcttttcatttaaaaactgat
tcagaaatgtaccaacattctattccaaaaattattgaaataatgaatcaacttattaaa
aaacaagaaattcaaaatgaaaatgaatttaaagaagaaatctataaaattattagaaca
tcatttaaacgtccaaatttattccaacaatatattagagaagataatgaaatcttttta
ttaatgattgaacttctttcaatgaatcttcataatgatattattgttttattattaaaa
ttacttagaagttctttcttaattaatgtggataaaactattagagaaaaaccaattaaa
tatggaattactcaacttcaaacaattattgaagaacgtcaaaaagttcttgatgattta
gaaaaaaataaagattctgaaagaatttttgttgaaagtatttgtaaagattctcatatt
cttcataacattattctttctttattacaattaaatgataaattaattaatattgaatta
actaaattaattgaaagtattggaaatttagctaatcaatatcaacgtaatactttatta
aatattttatgggattgttatcctcaatttaatacaaattctacattattatcaatgatt
agtactatttcattccttaaagctcaaggaactttaaagatagatcattctattaatcaa
tatttgaattaa

DBGET integrated database retrieval system