KEGG   Entamoeba dispar: EDI_281140Help
Entry
EDI_281140        CDS       T01083                                 

Definition
FKBP12-rapamycin complex-associated protein (EC:2.7.11.1 3.1.26.5)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
edi  Entamoeba dispar
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 2345 aa AA seqDB search
MTAQMKWSDKFMALFNELVLETSQTQNDIITKKLHDLVLIVVRDLQGDGVSTFINEISSN
LLRILKKPEVSEKQNNAIINLVDFFISSDIDDSYPRTNGKDIIDCIMKSSNQNVVQNASV
VLGKIIRLGPHDLVEKELDIANSYLEREPKINGALIMQEIGLNNQVICFMNQNKIIESLL
KGLYDKNINARTESEKALSILFNLFTSKESNNFDPEPLYKQAVIYLKQTNSADLQHGALL
LMVSLLRNCKEYMKPKYNEVLQMFLNVKEHKIMVIRKTVITSLPYFAEFDCESFAPKNKE
VIESFQKDRKSIADFAQFEHDELTKIKCEEPFNGIMNYLINSIKSFNDKSIVFTVIGDIT
KEIKFEMYAFVEQVYSKMREIINSKEKKVEILNSIMYCMEQFVINIPVPRVFALIHKTFP
TLLELGLSKSLVSLINQSCTIYNNPTYRLQTQKLLLDVICGILLGKAFIPFGAPEHLKMF
NRNIIPTVEGEEQIILALNTLHSFKFKHNIVPVVKECIMKYIDNETKKIRQEAAMLTQVL
LPPIDITKKFISTLDVTEVLEKLLDHGLSDSESEIRLTIMKLLDERFDSFLAQSKNIQTL
FVILNDENLKVREYAIKIIGRLTHYNPAFVMPLFRKTIIRLLTELQFINDLKTDEQVTLL
MGQLVKSSGKLTKPYVEPLLNILLPKLEESINKSHSTICIYILNIIGDLTTIGNDNNNNN
QYTQGLMKCIISVLQDKGNSQKKSLRRESALIALGKLVRSIGYVVQPYYDYPELLGLLIE
VASNERNQDIKIELIKVFGIIGAIDPYKYKLLTETEGVNQNDDSETVESLLPNSQIGTEE
FYAMTVIGLLLNILRDNNLVSGHEQTVKTFVKVICYLNRKTLPYIPQILSLYLKLFKTCT
INVRPALIKGLADIMYLIEKNIREYLPEIFILIQECWDDNTVLPILQLVCEIAKVMHDEF
KQYMPQMLSLIISELNKYVFEQNSLIFEKIINSIVILAEHIDFEDYLHLVIPSISDLVNE
QVHVSIVLPTLKALYKFLQYVNAEEFISRLVLPLTRLLQNEILRDTTMDVFCSIADNLGK
RFLVYAPTIKFALNKYCPKYINQRYETLTIKLQDIPDGLVLPIDENEGQNVTISEDLHTQ
VTNFNQDTTIKPNADIIKVIAVWETYRQRRSKEDWFDWFRQIAMVFLKESPSQSLCYCHL
LSTDHFPLARDLFNYAFLSMWQDSTDNSQRLTKCLIKVLENNNTPHEIIQTILNLCEFME
REGIKVPIKSLGDYSKKCNAYAKALHYKEQEFIENANINLIEELIGLNNQLQNYDAAAGL
IEYTKQIKQVQNNDTELNQTWYEKLGRWQQALNIYERKLQEDINNPELLVGKLNCLHEIG
DWESLDITAKTLWKIGDKKSISSARSLYAAALWYLDDWNEFDSIVSEMTENNFENNFFKS
INCIHNEEFEKAKNLINQQRIALDTELSSLVGEVYERSYSTIAKAQMLAELEEVIACKEG
LYNQDAKSILKSAWSEKLINAKADVSIWQKLLKIRSFVLTETENSESWIKFTGLCYKNGK
YKLAMKTLDRLAGINIENHLEELQPSKLRIGIQYLKLQWKGAKDIEEKKKLLNILQNFAN
IIEERRGDDLNLKAVVCSKLGEWNLYIAQNSNSFNYETIPNILMYYHSTIQYDPESYKYW
HHWALINFEIVSYIELDENYNEEVLVDYLKVSIEAFVKSLILTKNNQTLQDTLRLLTILF
KYGKYQEVEEAIIEGIRALPVDIWLHVIPQIIARIQSNVPAVKRVMTDLLTTIGKKHPQA
LVYPLTVASKSPSYDRRKTAMSVIEKIRTDSGHLVEQALLVSEELVRIAILWHEAWHEAL
EEASKEFYVNHSFDGMMAILQPLYDRLEKGGETQNERGFLQSYGKDLRDAFELCIRFKNK
GKRVSEKDHDIEGAWEIFFRIYKRIHKSINAVAVLELPHVSPRLMEAHDLDIAVPGTYKA
QNVNNIIRIKSIIPVLNIIPSKQRPRKLTIIGSNGKEYKYCLKGHEDLRQDERVMQLFGL
VNDLLASNSITSTHHLFITCYDVIPLSTMSGLIGWVPHSDTLHQLIKEYRECHNIPVDFE
KRLINKLCPRFDDLPFLQKVEVFERVLAESSGMDLANILWLKSSSSESWIDRRTNFTRSV
ALMSMVGYILGLGDRHPSNLMLQRFTGNVVHIDFGDCFEVAIHREKFPEKIPFRLTRMIV
NAMDVSGVEGTFRITCENVMTVLRENKDSLMAVLEAFVYDPLIVRLLGGKDVDDDDDKMN
KENQGENYVMKSKAVSVMRRVLEKLTGKDFGNEELNVHDQVDRLIREATSNENLSQSYQG
WCPYW
NT seq 7038 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagatgaagtggtctgataaatttatggcattattcaatgaacttgtatta
gagacgagtcaaacacaaaatgacattataacaaaaaaattgcatgatttagtacttatt
gtagtaagagatcttcaaggagatggagtatctacatttattaatgaaatatcatcaaat
ctcttaagaattcttaaaaaacctgaggtaagtgaaaaacaaaataatgcaataattaat
cttgttgacttctttattagttcagatattgatgattcatatccacgaactaatggtaaa
gatataattgattgtattatgaaatcaagtaatcaaaatgtagttcaaaatgcatcagta
gtattaggaaaaattattcgattaggaccacatgatttagtagagaaagaattagacatt
gctaatagttatttagaaagagaaccaaaaattaatggagcattaattatgcaagaaatt
ggattaaataatcaagtaatttgttttatgaatcaaaataaaataatagaaagtttactt
aaagggttatatgataaaaatattaatgcaagaactgaatcagaaaaagcattaagtata
ttatttaatttatttacatcaaaagaatcaaataattttgatccagaaccattatataaa
caagcagtaatatatttaaaacaaactaattcagcagatcttcaacatggagcattatta
ttaatggtaagtttattaagaaattgtaaagaatatatgaaacctaaatataatgaagta
ttacaaatgtttttaaatgtaaaagaacataaaattatggttattagaaaaactgttatt
acatcattaccatattttgcagaatttgattgtgaatcatttgcaccaaaaaataaagaa
gttatagaaagttttcaaaaagatagaaaaagtattgcagattttgcacaatttgaacat
gatgaattaacaaaaattaaatgtgaagaaccatttaatggaataatgaattatttaatt
aattcaataaaatcatttaatgataaaagtattgtatttacagttattggagatattaca
aaagaaatcaaatttgaaatgtatgcatttgtagaacaagtatattcaaaaatgagagaa
ataattaattctaaagaaaaaaaagtagaaatattaaattcaataatgtattgtatggaa
caatttgttattaatattccagtaccacgagtttttgcattaattcataaaacatttcca
acattattagaattaggattatcaaaatcattagtatcattaattaatcaaagttgtact
atatataataatcctacatatcgtcttcaaacacaaaaattattattagatgttatttgt
ggaatattattaggaaaagcatttattccatttggtgcacctgaacatttaaaaatgttt
aatagaaatattataccaacagtagaaggagaagaacaaataatattagcacttaataca
ttacattcatttaaatttaaacataatattgtaccagtagttaaagaatgtataatgaaa
tatatagataatgaaactaaaaaaatacgtcaagaagctgcaatgttaacacaagtactt
cttccaccaatagatataacaaaaaaatttatttctacacttgatgttacagaagtatta
gaaaaattacttgatcatggattaagtgattcagaaagtgaaattagattaacaataatg
aaattattagatgaacgatttgatagttttcttgcacaatcaaaaaatattcaaacactt
tttgttattttaaatgatgaaaatttaaaagttagagaatatgctattaaaattatagga
agattaacacattataatccagcatttgttatgccattatttagaaaaactattattagg
ttattaacagaattacaatttattaacgatcttaaaacagatgaacaagtaactctttta
atgggacaattagttaaatcatcaggtaaattaactaaaccatatgttgaaccattatta
aatattttattaccaaaattagaagaatcaataaataaatcacatagtacaatatgtatt
tatatattaaatataattggagatttaacaacaattggaaatgataataataataataat
caatatacacaaggattaatgaaatgtataattagtgtattacaagataaaggaaattca
caaaagaaaagtcttagaagagaatcagcattaattgcattaggaaaattagtaagaagt
attggatatgttgtacaaccatattatgattatccagaattacttggattattaattgaa
gttgcaagtaatgaaagaaatcaagatattaaaatagaattaataaaagtatttggaatt
attggagcaattgatccatataaatataaattattaacagaaacagaaggagtaaatcaa
aatgatgattcagaaacagttgaatcattattacctaattcacaaataggaacagaagaa
ttttatgcaatgacagtaattggattattacttaatattttaagagataataatcttgtt
tctggacatgaacaaacagtaaaaacatttgttaaagttatttgttatttaaatagaaaa
acattaccatatattccacaaattttatcattatatttaaaattatttaaaacatgtact
attaatgtaagaccagcattaattaaaggattagctgatattatgtatcttattgaaaaa
aatattagagaatatcttccagaaatatttatattaattcaagaatgttgggatgataat
acagtattaccaatattacaattagtttgtgaaattgctaaagtaatgcatgatgaattt
aaacaatatatgcctcaaatgctttcattaattatatcagaattaaataaatatgtattt
gaacaaaatagtttaatatttgaaaaaattattaattctattgttatattagctgaacat
attgattttgaagattatcttcatttagttattccaagtattagtgatcttgttaatgaa
caagttcatgtaagtattgttcttcctactttaaaagctttatataaatttttacaatat
gttaatgcagaagaatttattagtcgattagttcttccattaactagattattacaaaat
gaaattttaagagatacaactatggatgttttttgtagtatagcagataatcttggtaaa
agatttttagtttatgcaccaacaattaaatttgcattaaataaatattgtccaaaatat
attaatcaaagatatgaaacattaacaataaaacttcaagatatacctgatggacttgta
ttaccaatagatgaaaatgaaggacaaaatgttacaatatcagaagatcttcatacacaa
gttacaaactttaatcaagatacaacaattaaaccaaatgcagatataattaaagtaatt
gcagtttgggaaacatatagacaaagaagaagtaaagaagattggtttgattggtttaga
caaattgctatggtatttttaaaagaaagtccaagtcaatcattatgttattgtcattta
ttatcaacagaccattttccattagcaagagatttatttaattatgcatttttatcaatg
tggcaagattcaacagataattcacaaagattaactaaatgtttaataaaagtattagaa
aataataatactccacatgaaattattcaaacaatattaaatttatgtgaatttatggaa
agagaaggaattaaagttcctattaaatcacttggagattattcaaaaaaatgtaatgca
tatgctaaagcattacattataaagaacaagaatttattgaaaatgctaatattaattta
attgaagaacttattggattaaataatcaattacaaaattatgatgcagctgctggatta
attgaatatactaaacaaattaaacaagttcaaaataatgatacagaattaaatcaaaca
tggtatgaaaaattaggaagatggcaacaagcattaaatatttatgaaagaaaattacaa
gaagatattaataatccagaacttcttgttggtaaattaaattgtttacatgaaattgga
gattgggaatctcttgatataacagcaaaaacattatggaaaattggagataaaaaatca
atatcaagtgcaagatcattatatgcagcagcattatggtatttagatgattggaatgaa
tttgattcaattgttagtgaaatgactgaaaataattttgaaaataatttctttaaaagt
attaattgtattcataatgaagaatttgaaaaagctaaaaatcttattaatcaacaaaga
attgcattagatacagaattaagttcattagttggtgaagtatatgaaagatcatattct
actattgctaaagcacaaatgttagcagaattagaagaagttattgcatgtaaagaagga
ttatataatcaagatgctaaaagtattttaaaatcagcatggagtgaaaaattaataaat
gctaaagcagatgtaagtatttggcaaaaattattaaaaataagaagttttgtattaaca
gaaacagaaaatagtgaatcatggattaaatttacaggattatgttataaaaatggaaaa
tataaattagcaatgaaaactcttgatagattagctggaattaatattgaaaatcatctt
gaagaattacaaccaagtaaacttcgtattggaattcaatatcttaaattacaatggaaa
ggagctaaagatattgaagaaaaaaagaaattattaaatatattacaaaattttgcaaat
attattgaagaaagaagaggagatgatttaaatttaaaagcagttgtttgttcaaaatta
ggtgaatggaatttatatattgcacaaaatagtaattcatttaattatgaaactatacct
aatattttaatgtattatcatagtacaattcaatatgatcctgaaagttataaatattgg
catcattgggcattaattaattttgaaattgtttcatatattgaattagatgaaaattat
aatgaagaagtattagtagattatcttaaagttagtattgaagcatttgtaaaatcactt
attttaactaaaaataatcaaactttacaagatactcttagacttttaactattttattt
aaatatggaaaatatcaagaagtagaagaagctattattgaaggtattcgtgctcttcct
gtagatatttggttacatgttattccacaaattattgcacgtattcaatcaaatgtacct
gctgttaaaagagtaatgacagatttattaactactattggtaaaaaacatccacaagca
cttgtttatccattaactgttgcatctaaatcaccttcatatgatagaagaaaaactgct
atgtctgttattgaaaaaattagaacagattctggacatcttgttgaacaagcattactt
gttagtgaagaacttgttcgtattgctattttatggcatgaagcatggcatgaagcactt
gaagaagcatcaaaagaattttatgttaatcattcatttgatggaatgatggcaatttta
caaccattatatgatagattagaaaaaggtggtgaaacacaaaatgaaagaggattttta
caatcttatggaaaagatcttagagatgcatttgaactttgtataagatttaaaaataaa
ggaaaaagagtatcagaaaaagatcatgatatagaaggtgcttgggaaattttctttaga
atttataaaagaattcataaatctattaatgctgttgctgtattagaattacctcatgtt
tcacctagattaatggaagctcatgatcttgatattgcagtacctggaacatataaagca
caaaatgttaataatattattagaattaaatctattataccagttcttaatattattcca
tctaaacaaagaccaagaaaacttacaattattggatcaaatggaaaagaatataaatat
tgtttaaaaggacatgaagatttaagacaagatgaacgtgttatgcaattatttggttta
gttaatgatttattagcaagtaattctattacttctacacatcatttatttattacttgt
tatgatgttattccattaagtacaatgagtggattaattggttgggtacctcatagtgat
acattacatcaattaataaaagaatatagagaatgtcataatattccagttgattttgaa
aaaagattaataaataaattatgtcctagatttgatgatcttccatttttacaaaaagtt
gaagtctttgaaagagttttagctgaatcttctggaatggatttagcaaatattttatgg
ttaaaaagttcttcttcagaatcttggattgatagaagaactaattttactagaagtgtt
gctttaatgtcaatggttggttatattcttggtcttggtgatagacatccttctaatcta
atgttacaacgttttactggaaatgttgttcatattgattttggtgattgttttgaagtt
gctattcatcgtgaaaaattccctgaaaaaattccttttagattaactagaatgattgtt
aatgctatggatgttagtggtgtagaaggtacttttagaattacttgtgaaaatgttatg
acagttttaagagaaaataaagatagtttaatggctgttttagaagcatttgtatatgat
cctttaattgttagattacttggtggtaaggatgttgatgatgacgatgataaaatgaat
aaagaaaatcaaggtgaaaattatgtcatgaaatctaaagctgtttctgtaatgagaaga
gtattagaaaaattaactggaaaagattttggaaatgaagaattaaatgttcatgatcaa
gtagatagattgattagagaagcaacctcaaatgaaaatcttagtcaatcatatcaagga
tggtgtccatattggtaa

DBGET integrated database retrieval system