KEGG   Entamoeba dispar: EDI_282670Help
Entry
EDI_282670        CDS       T01083                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
edi  Entamoeba dispar
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EDI_282670
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EDI_282670
Exosome [BR:edi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EDI_282670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 485 aa AA seqDB search
MKYILAIDQGTTSTRVILFDEKCQSVHTEQEEFDSIFPHPGWVEQDPEIIYTCVVNLMKR
CLVNTGINKQDIAAIGITNQRETTVMWDKRTGKPIYNAIVWQSKQSGNETSYLMEKGYGE
LFHSKTGLVLNPYFSASKIMWIFNHVECAKALAKEGVLLFGTIDTWIIYNLTGGQSHFTD
ISNAARTLLFNIYEKKWDDELLVKTDIPKSILPVVKQSSDDFGIISTIQEFNGIHITGVA
GDQQASLFGHGSPIGGCKSTYGTGCFVVKNIGNSIKEIPKGLLATIGWEIDGKITYALEG
SVMTAGAALKWIRDIGILKDYNEISKIVPSKNGGVYFVPAFQGLGTPYWDDDVRGIIVGL
TSGTGKGELVRATLESIALQCAQVIEIMGKINEIKVDGGVSRSDCMLQFQADICNCTVVR
LKEKEITAMGAAMLAGLYIHLFKEDELDSMRVIEHIFKPQMSEEERKQIFSLWNKAVESA
RSFVH
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatacttgccattgatcaaggcactacaagcactagagttattttgtttgat
gaaaagtgtcaatcagtccacacagaacaagaagaatttgattctatttttccacatcca
ggttgggttgaacaagatcctgaaataatttatacttgtgttgttaatttgatgaagagg
tgtcttgttaatactggcattaataaacaagacattgcagctattggaataactaatcaa
agagagaccacagttatgtgggataaaagaactggaaagcctatttataatgcaatagtc
tggcaatccaaacaatcaggaaatgaaacgtcttatcttatggagaagggttatggtgaa
ttgtttcattctaaaactggattagtactaaatccttattttagtgctagcaaaattatg
tggatatttaatcatgtcgaatgtgcaaaagcattagccaaagaaggtgttttattattt
gggactattgatacttggattatctataatctgactggaggtcaaagtcatttcactgac
atatcaaatgcagcacgtacattattgtttaatatttacgaaaagaaatgggatgatgaa
ttattagtaaaaacagatattccaaagtcaattctgccagtagttaaacaatcttctgat
gattttggtattatttccactattcaagaatttaatggaattcatattactggagttgct
ggtgatcaacaagcatcactttttggacatggaagtcctattggaggatgcaaatcaacc
tatggaactgggtgtttcgttgtaaaaaatattgggaattcaattaaagaaataccaaaa
ggattgttagcaactattggatgggaaattgatggaaaaataacatatgctcttgagggt
tcagttatgactgctggggcagcactaaagtggataagagatataggaatactaaaagac
tataatgaaatatcaaaaatcgttccttcaaaaaatggtggagtttattttgtaccagca
tttcagggacttggcacaccttattgggatgatgacgttcgtggtataattgttggatta
actagtggcactggaaaaggtgaattagttcgagctactctagaaagtattgctttacaa
tgcgcccaagtaatcgaaattatgggaaaaattaatgagattaaagtagatggaggagtc
tcacgatctgattgtatgctccagtttcaagcagatatatgcaattgtactgttgttaga
ttgaaagaaaaagaaattactgcaatgggagcagctatgttagccgggttatatattcat
ttatttaaagaagatgagttagattcaatgagagtaattgagcatatatttaaacctcaa
atgagtgaagaagaaagaaagcaaatattttcactttggaataaagcagtagaatcagca
cgttcatttgttcattag

DBGET integrated database retrieval system