KEGG   Entamoeba dispar: EDI_289590Help
Entry
EDI_289590        CDS       T01083                                 

Definition
mitogen-activated protein kinase (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     EDI_289590
Protein kinases [BR:edi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   EDI_289590
Exosome [BR:edi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EDI_289590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 340 aa AA seqDB search
MNSRTTQIKNNSYEDPLTQRYVLQGLIDKGSEGIVYSILHKKSGQLLACKKIEIGESRIN
GLRVLQEIRLLKYLNHENIIHLEEYLYAQIESVNTVFLIYELFPRNLSESIKSGRITAST
QMKYIISQLASSLYYLHINNFIHRDVKPSNILINDRFKIKLCDFGSCKCLNQKESYPTIQ
SVCTKIYMPPEYFYEGVEETTTIDIWQLGCVYIQMILRAPPFKGHSVNSIKKSILSLIKP
DEIIKFNNNEEVNESYGLKETKTILPYFFRTLKIDSSSQELIYDMLQIDPLKRITAIEIL
QHQSVAMFKQPLGEKESNEFEFVKGNETYDEIVQLIKNEM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaatagccgtacaacacaaataaaaaataattcatatgaggatcccctcactcaaaga
tatgttttacaaggacttattgacaaaggttcagaaggtatagtttattctattttacat
aaaaaatcaggacaattgctagcgtgtaaaaaaattgaaattggggagtcaagaataaat
ggtctaagagtattacaagaaattagactcttaaaatatttaaatcatgaaaatattatt
cacttagaagaatatctttatgctcaaattgaatctgttaatactgtttttctaatctat
gaactattcccaagaaatttatcagagagtatcaaatcaggaaggattactgcatcaacc
caaatgaaatatatcatttcacaattggcttcttcactatattatttacatattaataat
tttattcatcgagatgttaaaccaagcaatatactaatcaatgatagatttaaaataaaa
ttgtgtgattttggatcatgtaaatgtttaaaccaaaaagagtcatatccaacaattcaa
agtgtatgtactaaaatttatatgcctccagaatatttttatgaaggagttgaagaaact
actactatcgatatttggcagttgggttgtgtttatatacaaatgattttacgagcacca
ccatttaaaggtcattctgtaaattctattaaaaaatcaattttatcgttaattaaacca
gacgaaataattaaatttaataacaatgaggaagtaaatgagtcatatggattaaaagaa
accaagactattttaccatatttctttaggacattaaaaattgattcttcttcacaagaa
ttaatttatgatatgttacaaatagatccattaaaaagaattacagcaattgaaattcta
caacaccaatcagttgctatgtttaaacaaccattaggtgaaaaagaaagtaatgaattt
gaatttgtaaaaggaaacgagacttatgacgaaatcgttcaattaataaaaaacgaaatg
taa

DBGET integrated database retrieval system