KEGG   Entamoeba dispar: EDI_313240Help
Entry
EDI_313240        CDS       T01083                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
Organism
edi  Entamoeba dispar
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 340 aa AA seqDB search
MSFLNFFNSPKIKGTNGIHNLGNTCYMNAVIQCIAHTQQFLEYALEYQLKVYTNENNTKS
SLIENVTESLIKTIQALYTHKESIYPQYFFTTFGILNQQFADKKQKDAAEFLLLLLDVMD
NDLRGTSITQPPAIIHNELYYKDYIEYIRNNKSIITQMTTGMVVSKFCCEICGTSSIHSE
PFSLLQLPIMKNLSFLKKVNLENYFELKELKYITIYDCLIGYLYSFQTCVKCNHTQIPNR
NFVVTPPILIIQILRFEQQSNNTQKDQTTVFFPLNDFVIGIAKYQLYATIDHIGSINQGH
FTANCKINDLWYRFDDETVKPLNKIDIVSDKSYILFYERT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttctaaacttctttaactcaccaaaaattaaaggaacaaatgggattcataat
ttaggtaatacatgttatatgaatgctgtaatacagtgcattgcacatacccaacaattt
ttagaatatgcattagaatatcagttaaaagtttatacgaatgaaaataatacaaaaagt
tcattaatagaaaatgttaccgagtctttaataaaaacaatccaagcattatatactcat
aaagaatcaatttaccctcaatatttttttactacttttggtattctcaaccaacaattt
gctgataaaaaacaaaaagatgctgcagaatttttgttattattacttgatgttatggat
aatgatcttcgaggtacaagtataactcaaccaccagctataatacataatgaattgtat
tataaagattatattgaatatattagaaataataaatcaattattactcaaatgacaact
gggatggttgtaagtaaattttgttgtgaaatttgtggaacatcttcaattcattctgaa
ccattttcattattacaattgccaattatgaaaaatctttcatttttaaaaaaagttaat
ttagaaaattattttgaattaaaagaattaaaatatataacaatttatgactgtttaatt
ggttatttatattcttttcaaacttgtgttaaatgtaatcatacacaaattcctaataga
aatttcgttgtaacacctcctattcttattattcaaattcttcgatttgaacaacaatca
aataatactcaaaaagatcaaactactgtttttttccctttaaatgactttgttattgga
atagcaaaatatcaattgtatgcaactattgatcatataggctcaattaatcaaggtcat
tttactgctaattgtaaaataaatgatttatggtatcgttttgatgatgaaacagtaaaa
cctcttaataaaatagatattgtttcagacaaatcatatatactgttttatgaaagaact
taa

DBGET integrated database retrieval system