KEGG   Entamoeba dispar: EDI_313240Help
Entry
EDI_313240        CDS       T01083                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EDI_313240
Peptidases [BR:edi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EDI_313240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 340 aa AA seqDB search
MSFLNFFNSPKIKGTNGIHNLGNTCYMNAVIQCIAHTQQFLEYALEYQLKVYTNENNTKS
SLIENVTESLIKTIQALYTHKESIYPQYFFTTFGILNQQFADKKQKDAAEFLLLLLDVMD
NDLRGTSITQPPAIIHNELYYKDYIEYIRNNKSIITQMTTGMVVSKFCCEICGTSSIHSE
PFSLLQLPIMKNLSFLKKVNLENYFELKELKYITIYDCLIGYLYSFQTCVKCNHTQIPNR
NFVVTPPILIIQILRFEQQSNNTQKDQTTVFFPLNDFVIGIAKYQLYATIDHIGSINQGH
FTANCKINDLWYRFDDETVKPLNKIDIVSDKSYILFYERT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttctaaacttctttaactcaccaaaaattaaaggaacaaatgggattcataat
ttaggtaatacatgttatatgaatgctgtaatacagtgcattgcacatacccaacaattt
ttagaatatgcattagaatatcagttaaaagtttatacgaatgaaaataatacaaaaagt
tcattaatagaaaatgttaccgagtctttaataaaaacaatccaagcattatatactcat
aaagaatcaatttaccctcaatatttttttactacttttggtattctcaaccaacaattt
gctgataaaaaacaaaaagatgctgcagaatttttgttattattacttgatgttatggat
aatgatcttcgaggtacaagtataactcaaccaccagctataatacataatgaattgtat
tataaagattatattgaatatattagaaataataaatcaattattactcaaatgacaact
gggatggttgtaagtaaattttgttgtgaaatttgtggaacatcttcaattcattctgaa
ccattttcattattacaattgccaattatgaaaaatctttcatttttaaaaaaagttaat
ttagaaaattattttgaattaaaagaattaaaatatataacaatttatgactgtttaatt
ggttatttatattcttttcaaacttgtgttaaatgtaatcatacacaaattcctaataga
aatttcgttgtaacacctcctattcttattattcaaattcttcgatttgaacaacaatca
aataatactcaaaaagatcaaactactgtttttttccctttaaatgactttgttattgga
atagcaaaatatcaattgtatgcaactattgatcatataggctcaattaatcaaggtcat
tttactgctaattgtaaaataaatgatttatggtatcgttttgatgatgaaacagtaaaa
cctcttaataaaatagatattgtttcagacaaatcatatatactgttttatgaaagaact
taa

DBGET integrated database retrieval system