KEGG   Entamoeba dispar: EDI_313840Help
Entry
EDI_313840        CDS       T01083                                 

Definition
eukaryotic translation initiation factor 3 subunit (EC:3.6.3.14)
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
edi  Entamoeba dispar
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EDI_313840
Messenger RNA biogenesis [BR:edi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     EDI_313840
Translation factors [BR:edi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    EDI_313840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 664 aa AA seqDB search
MSASTKTSKITQSSVLICDGLPVGIPVASVSKLTLFLKRMVLIKNGAELSEQPNNVIVFV
DETSQKTTGIGFIDFKDDEAAIKFKTRFVELKFDNKNTLKFYTKKEIDEILKENDEYTPL
VFNPIEVTDFKGWLKEDKYTEGNECFATFQYGKTISLGWYNPSIPKEITMQEEQPFISSN
CSFSPSGTFLYSITEHGLIVVQPDCKKKFQFPHSGLTHVTISPHDTFIATYSATAPYNRH
IIVWDRRFTKGIKFFDLKANSLKRMTETLKKDKTLTPIGQDFVQFSYNEKYLARISEVDS
NSIEIYTTPTIQLLSNKLVTFESSIDKISWSPKSNIIVAYHEPLQKTNEQAHFYFYDVDK
QEIIFKHKVFSLKGAEFGWHSSGKKLVVQCNKNKKTAVLVFTLDKTITASMNELNATPHF
MSVNPIKMQFGIMAYQHSKKGDSLFPTLHIYDISSNETKLISSLPNIEAKSFIYSPNGQF
MVVSGINTSEPYLYFYNTDRMKLYKKVPIENMSYICWDPMGLFLGAVRSYVYSPHAKNGF
MLYDCFGNLQFETYKTNFAGLLWRPQPTNIIKPEMAKEVESKFNECLKTMKEEDERKKEQ
IELEKKQRADELMKRFRNIVQKNVQLSAKEHLRAYDSGMKIIVEEIKQKAESNEEVKENI
TETQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttcaactaaaacgtctaaaattacacaatcttctgtacttatctgtgatgga
cttccagtaggaattcctgttgcttcagtttctaaattaacattattcttaaaaagaatg
gtattgataaagaatggagcagaattatctgaacaaccaaataatgtaatagtttttgtt
gatgaaacaagccaaaaaactacagggattgggtttattgattttaaagatgatgaagca
gcaataaaatttaaaacaagatttgttgaattaaaatttgataataaaaatacgttaaaa
ttttatactaaaaaagaaattgatgaaattttaaaagaaaatgatgaatatacaccatta
gtctttaatccaattgaagttactgattttaaaggatggcttaaagaagataaatatact
gaaggaaatgaatgttttgcaacatttcaatatggaaaaactatttcattaggatggtat
aacccaagtattccaaaagaaataacaatgcaagaagaacaaccatttatatcatctaat
tgttcattttcaccatcaggtacatttttatattcaatcactgaacatggattaattgta
gttcaaccagattgtaaaaagaagttccaatttccacattcaggattaacacatgttact
atttcaccacatgatacatttattgctacatattcagctacagcaccttataatagacat
attattgtttgggatagaagatttacaaaaggtattaaattctttgatttaaaagcaaat
agtttaaaaagaatgacagaaacattaaaaaaagataaaactttaacaccaattggacaa
gattttgttcaatttagttataatgaaaaatatttagctagaattagtgaagttgattct
aattcaattgaaatatatactacaccaacaattcaattattaagtaataaattagttaca
tttgaaagttcaattgataaaattagttggagtcctaaatcaaatattattgttgcttat
catgaaccacttcaaaaaactaatgaacaagcacatttctacttttatgatgttgataaa
caagaaattatttttaaacataaagtattttcattaaaaggagcagaatttggatggcat
tcatcaggaaagaaattagttgttcaatgcaataaaaataagaaaacagctgttttagta
tttacattagataaaacaattactgcatctatgaatgaattaaatgctacacctcatttt
atgagtgttaatccaataaaaatgcaatttggtattatggcatatcaacatagtaaaaaa
ggagattcattattcccaacattacatatttatgatattagtagtaatgaaactaaatta
atttcatcacttcctaatatcgaagctaaatcatttatttattcaccaaatggacaattt
atggtagtaagtggaattaatacatcagaaccatatttatatttctataatactgataga
atgaaattatataaaaaagttccaattgaaaatatgagttatatttgttgggatccaatg
ggattattccttggtgcagttcgttcatatgtttattctccacatgcaaagaatggattt
atgttatatgattgttttggaaatttacaatttgaaacatacaaaactaattttgctgga
ttattatggagaccacaaccaacaaatattattaaacctgaaatggctaaagaagttgaa
agtaaatttaatgaatgtttaaagacaatgaaagaagaagatgaacgaaagaaagaacaa
attgaattagaaaagaaacaaagagctgatgaattaatgaaaaggttcagaaatattgtt
caaaagaatgttcaattatctgctaaagaacatttaagagcttatgattctggaatgaaa
attattgttgaagaaattaaacaaaaggcagaatctaatgaagaagtaaaagaaaatata
acagaaactcagtaa

DBGET integrated database retrieval system