KEGG   Entamoeba dispar: EDI_317200Help
Entry
EDI_317200        CDS       T01083                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
edi  Entamoeba dispar
Brite
Exosome [BR:edi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EDI_317200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 133 aa AA seqDB search
MSDKASQKKSVATKDATKPKKAGDEEKKTMLKKNFESYALYISRVLKSVFQDIGITLPSI
SIMDSFVRDIFERIATEASSLARNYNKTTITVKEIETATKLILKGDLNKHAVSEGQSAVK
RASGKGSTSGSQA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaaagccagtcaaaagaaatctgttgctactaaagacgctaccaagccaaaa
aaagctggagatgaagaaaagaaaactatgcttaagaagaattttgagtcatatgcttta
tacatttcaagagttttgaaatcagttttccaagatattggaattacacttccatctatt
tctattatggattcatttgttcgtgacatttttgaaagaattgctactgaagcatcatct
cttgcaagaaattataataaaaccacaatcactgtcaaagaaattgaaacagctactaaa
ctcattcttaaaggtgatttgaataaacatgcagtttctgaaggacaatcagctgttaag
agagcatctggtaaaggaagcacttcaggatctcaagcttaa

DBGET integrated database retrieval system