KEGG   Entamoeba dispar: EDI_325300Help
Entry
EDI_325300        CDS       T01083                                 

Definition
eukaryotic translation initiation factor 4E-2
Orthology
K03259  
translation initiation factor 4E
Organism
edi  Entamoeba dispar
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EDI_325300
Translation factors [BR:edi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    EDI_325300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 179 aa AA seqDB search
MNLILKIEMEHKLFSEWTFWFDGFSNKSTETYGSNIVSIGSFKTAEEFWGIYDAIPKLGT
MENGSDVSLFKNGIKPIWEDTSNVGGGRIQTILTNTNNELCQQYWRDTILSLIGETIPSA
YCINGAAFSVRQHNKIALWLDKSGKEHLNEISKKLRDIIPCDGTIIYYSHDPSVEPIVC
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaatattaaaaatagagatggaacataaattattcagtgaatggactttttgg
tttgatggattttcaaataaatcaactgaaacatatggatcaaacattgtctctattgga
agcttcaaaactgctgaagaattttggggaatatatgacgctattcctaaattaggaaca
atggaaaatggatcagatgtttcattattcaaaaatggaattaaaccaatatgggaagac
accagtaatgttgggggtggaaggatacaaacaattttaactaacactaataatgaatta
tgtcaacaatactggagagatactatattaagtttaatcggtgagactattccttctgct
tattgtattaatggtgctgcattttctgttcgtcaacacaataaaattgcattatggctt
gataaatcaggaaaagaacacttaaatgaaatatcaaagaaattaagagacattatccct
tgtgatgggactatcatatattacagccatgacccttctgtagagcccatagtgtgttaa

DBGET integrated database retrieval system