KEGG   Entamoeba dispar: EDI_332330Help
Entry
EDI_332330        CDS       T01083                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
edi  Entamoeba dispar
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EDI_332330
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EDI_332330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
MGKYQVLVLFGPSGAGKSTIMHHLMEKYPGKFSFSISHTTRKPRGKEQNGVDYYFIEEEE
MKKMIEENKFIEHAHVHTAFYGTSKMEIERIAKNNQIAILDIDLQGSRQIRGKVAAFFLF
IAPPSMEILEQRLRLRGTETEEQVQVRLKNALIEMEGEKEADAVVVNNVFTEGYGKIDET
IEKNLF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaatatcaggttcttgttctttttggtcctagtggagcaggtaaatcaacaata
atgcaccaccttatggaaaaatatccagggaaattttcatttagtatttcacatacaaca
agaaaaccaagaggtaaagaacaaaatggagttgattattacttcatcgaagaagaagaa
atgaagaaaatgattgaagaaaataaatttattgaacacgctcatgttcatacagccttc
tacggtacatcaaaaatggaaattgaacgcattgctaagaacaatcaaattgcaattctt
gatattgaccttcaaggtagcagacaaatcagaggtaaagttgcagcattctttttattt
attgcacctccttcaatggaaattttagaacaacgtttacgtttaagaggtacagagaca
gaagaacaagttcaagttcgtttaaagaatgcacttattgaaatggaaggagaaaaagaa
gcagatgcagtagttgtgaataatgtattcacagaaggatatggtaagatagatgaaact
atagaaaagaatttgttttaa

DBGET integrated database retrieval system