KEGG   Entamoeba dispar: EDI_335100Help
Entry
EDI_335100        CDS       T01083                                 

Definition
beta-hexosaminidase alpha chain precursor (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
edi  Entamoeba dispar
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:edi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:edi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:edi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 562 aa AA seqDB search
MLFLFIVLISTAFAGNGLNVQNQLLLMPYPSSVSFQWKSSLAIALTSSIQLNVKSTCNTD
CMNFLKSNFNHTISFPLQQQTGLQDFKVSLFEEIDLPRITPSISSVVTDVFLEFSSSNPM
PKLQIGVDESYVLEVTTNGISIKAVTVYGARHAFETLLQLIRISSKKFVISQLPIKISDA
PRFKWRGLMVDPSRNPLSPLMFKRIIDTLASVKANVLHIHLSDAQTFVFESKKYPLLHQK
GMYDQSFVLTQSFLKELTQYGANRGVIVYGEIDTPAHTASWNLGYPGVVANCWDYIVSTS
MRYGENVLSLNPANPNTFPIIDALMKELSDTFGTDYVHVGGDEVWTSGWSKSKEYNDIQN
FMKSKGINSLTELEGYFNKYAQEQVINNGKHPVVWEEVFKKGNADKSTIVQVWDDIRLLQ
QVVSSGYKAIFSAGFYLDKQMPLCNNYDSSTCINTHSMWVWTNRDMYDNDPVKSLSSSEK
ENVLGGEGCSWGESTDEQNFFDRVFQRYSAIAERLWSKESVVDKESHEVRANYLRCLDVR
RDIMKGTGPLYHAFCQLPKKNN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgttattccttttcattgtacttatttctacagcctttgctggaaatggtctgaatgtc
cagaaccaattacttttaatgccatatccaagttcagtatcgtttcaatggaaatcatca
ttagctattgcactaacttcttctattcagttaaatgtaaaatcaacttgcaatactgat
tgtatgaacttccttaaatcaaatttcaatcacactatttcattccctttacaacaacaa
acaggtttacaagattttaaagtgtcgttatttgaagaaatagatttaccaagaataact
ccatcaatttcaagtgttgtaactgatgtttttttagagttttcttcttcaaatcctatg
ccaaaattacaaattggggttgacgaaagttatgttcttgaagttactactaatggtatt
tccattaaagcagttactgtatatggtgcacgtcatgcatttgaaacattacttcaatta
attagaatttcatcaaagaaattcgtaatttcacaattaccaattaaaataagtgatgca
ccaagatttaaatggagaggattaatggtagacccttcaagaaatccattatctcctttg
atgtttaaaagaattattgatacattggcatcagttaaagcaaatgttttgcatattcat
ttaagtgatgcacaaacatttgtctttgaatcaaagaaatatccactgttacatcaaaaa
ggaatgtatgatcaaagttttgttcttacacaatcttttcttaaagaattaacacaatat
ggtgctaatagaggtgttattgtttatggagaaattgatacacctgcacatactgcatca
tggaatcttggatatccaggtgtggttgctaattgttgggattatattgttagtacttca
atgagatatggagagaatgttctttcattaaacccagctaatccaaatactttcccaata
attgacgcattaatgaaagaattgtcagacacatttggtactgattatgttcatgttgga
ggtgacgaagtatggacaagtggatggtcaaaatcaaaggaatataatgatattcaaaat
ttcatgaaatcaaaaggaatcaattctcttacagagttagaaggatattttaataagtac
gcacaagaacaagtgattaataatggtaaacatccagttgtatgggaagaagtatttaaa
aaaggaaatgctgacaaaagcactattgttcaagtatgggatgatattagattacttcaa
caagttgttagctcaggttataaagcaatattttcagcaggattttatttagataaacaa
atgccattatgcaataattatgattctagcacttgtattaacactcattcgatgtgggta
tggactaatagagatatgtatgacaatgaccctgttaaatcactttcttcatcagaaaag
gaaaatgtattaggaggtgaaggttgttcatggggagaaagtactgatgaacaaaacttc
tttgatagggttttccagagatattctgcaattgcagaaaggctttggagtaaagagagt
gttgttgacaaagaaagtcatgaagttcgtgcaaattatttaagatgtcttgatgttaga
agagatatcatgaaaggtactggaccattgtaccatgcattctgtcaacttccaaagaag
aataattga

DBGET integrated database retrieval system