KEGG   Entamoeba dispar: EDI_336480Help
Entry
EDI_336480        CDS       T01083                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
Organism
edi  Entamoeba dispar
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 379 aa AA seqDB search
MSKYVGRLFSPRDDHVKKFFSNYPICGIRNLGNTCFISSVLQSLANTQQIRSYCYHHYNP
IKGRAGDKSVYHGSLLNAFINLTNAIWSGNYRFVTSLAIKDIVSETHPQYKGKEQNDAHE
FLLIFLEILEKELNTKDINDFSSSISPQLLSPIPCRGTIKTYSRETSPSKEYYSPFEVEM
NEIGSDDSSSDYYFSKNLISDVFRGRIKRVTECSICHSSSETFEEFISLSVPVPQWYSNE
THPISLESCIELFLHYENVEDWYCEECNQKRKAKIYSTINDIPKVLIIQLVRIYSKKYPT
QQVLFPLNDLVVQTSPNHFDFYDLYSFITHTGSLSKGHYISWNRVLDQWYCCNDENVSQS
KPNTSSDTVYILFYKRKVS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtatgtgggaagattattctcacctcgtgatgaccatgtcaagaagttcttt
tcaaactatccaatttgtggaatcagaaatttaggaaacacttgttttatcagttcagtt
ttacaatctctagctaacactcaacaaattcggtcatactgttatcatcactacaatcca
attaaaggaagagcaggagataagtcagtatatcatggatctcttctaaatgcatttatc
aatctaacaaacgctatttggtcaggaaattatagatttgtaacttctttagcaattaaa
gatattgtatcagaaacacatccacagtataagggaaaggaacaaaatgatgcacatgaa
tttttgttaatctttcttgaaatcttagaaaaagaattaaatacaaaagatataaatgat
ttctcttcttctatttcaccacaacttctctctccaattccatgtagaggtacaataaaa
acatattctcgtgaaacttctccttcaaaagaatattattctccatttgaagttgaaatg
aatgagattggatctgatgattcatcttcagactattacttttcaaaaaatcttattagt
gatgtttttagaggaagaattaaaagagtaactgaatgttcaatctgtcattctagttca
gagacttttgaggaatttatttcattatcagttccagtacctcaatggtattcaaatgaa
acacacccaatctcattagagagttgtattgaattatttcttcactatgaaaatgtagag
gattggtattgtgaagaatgtaatcaaaagagaaaagctaaaatatattcaactatcaat
gacattcctaaagttttaattattcaattggttagaatatattcaaagaaatacccaact
caacaagtcttgtttcctttaaatgacttagtggtccaaacatcacctaaccattttgat
ttttatgatttatattcttttatcactcatacaggatcactatcaaaaggccattatata
tcatggaatagagtattagatcaatggtactgttgcaacgatgaaaatgtttctcagtct
aaacctaatacatcatctgatactgtgtacattctcttttataaaaggaaggtaagttga

DBGET integrated database retrieval system