KEGG   Entamoeba dispar: EDI_338230Help
Entry
EDI_338230        CDS       T01083                                 

Definition
myst histone acetyltransferase (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EDI_338230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 413 aa AA seqDB search
MNIIRFKINEKVLCHKHEDPEGSYREARILDTRENNGNTEYYIRYTEYNKRLDEWTTTNN
IIRYSSKENIIRPTTKEDGIGQRKMTRSLRQSNVSMLEKDSEINDKIGTQENEIFQRTKN
IQNVTIGDYDLNVWYFSPYPGEYGHVERLYICEHCLKYMSKANTYIKHREHCPYHFPPGL
LIYKDDKKHLAFFEVDGAEAKMFCQSLCLLSKMFLDHKTLYYDVEPFYFYILCEFNYNEQ
WKSDDYHIVGYFSKEKASPDGYNLSCLMVLPHYQRKGYGKMLISMSYELSKIEGIPGSPE
KPLSDLGLVSFKSYWSGVIAEELLNSTEIPSIEDLTLKTGITKEDCVSTLDTLGCISPYR
GSQIISINQNTMEKLRKKSLENKVLVKKELLHWKPHSVVVKYPNVMQTLRTYC
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcataagatttaagataaatgaaaaagtattatgtcataaacatgaagaccct
gaaggatcatatagagaagcaagaattcttgatacaagagaaaataatggaaatacagaa
tattatattagatatacagaatataataaacgattagatgaatggacaacaacaaataat
attatacgatattcatcaaaagaaaatattattagacctacaacaaaagaagatggaatt
ggtcaacgtaaaatgacaagatcattacgtcaatcaaatgtttcaatgttagaaaaagat
agtgaaattaatgataaaataggaacacaagaaaatgaaatatttcaaagaacaaaaaat
attcaaaatgttactattggagattatgatttaaatgtatggtatttttcaccatatcct
ggagaatatggacatgtagaaagattatatatttgtgaacattgtcttaaatatatgtct
aaagcaaatacttatattaaacatagagaacattgtccatatcattttccaccaggatta
ttaatttataaagatgataaaaaacatttagcattttttgaagttgatggagcagaagca
aaaatgttttgtcaatcactttgtttattaagtaaaatgtttttagatcataaaacatta
tattatgatgtagaaccattttatttctatattctttgtgaatttaattataatgaacaa
tggaaaagtgatgattatcatattgttggttatttttcaaaagaaaaagctagtcctgat
ggttataatttaagttgtttaatggtattaccacattatcaaagaaaaggatatggtaaa
atgcttatttcaatgagttatgaattaagtaaaattgaaggaattccaggtagtccagaa
aaaccattaagtgatttaggattagttagttttaaaagttattggtcaggagtaattgca
gaagaattattaaattcaactgagattccttctattgaagaccttactttaaaaacagga
ataacaaaagaagattgtgttagtactttagatactttaggttgtatttctccatatcga
ggatcacaaattatttcaattaaccaaaatacaatggaaaaattacgtaaaaaatcttta
gagaataaggttttagtaaaaaaagaattacttcattggaaaccacattcagtagtagta
aaatatcctaatgttatgcaaacacttaggacatattgttaa

DBGET integrated database retrieval system