KEGG   Entamoeba dispar: EDI_342050Help
Entry
EDI_342050        CDS       T01083                                 

Definition
alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
edi  Entamoeba dispar
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Amoebiasis
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EDI_342050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EDI_342050
   00620 Pyruvate metabolism
    EDI_342050
   00650 Butanoate metabolism
    EDI_342050
  Lipid metabolism
   00071 Fatty acid degradation
    EDI_342050
  Amino acid metabolism
   00350 Tyrosine metabolism
    EDI_342050
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    EDI_342050
Enzymes [BR:edi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EDI_342050
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EDI_342050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 870 aa AA seqDB search
MSAQQSMTVDEHINQLVAKAQVALKEYLKPEFTQEKIDYIVKKASVAALDQHCALAAAAV
EETGRGIFEDKATKNIFACEHVTHEMRHAKTVGIVNVDPLYGITEIAEPVGVVCGVTPVT
NPTSTAIFKSLISIKTRNPIVFSFHPSALKCSIMAAKIVRDAAIAAGAPENCIQWIEFGG
IEASNKLMNHPGVATILATGGNAMVKAAYSSGKPALGVGAGNVPTYIEKTCNIKQAANDV
VMSKSFDNGMICASEQAAIIDKEIYDQVVEEMKTLGAYFINEEEKAKLEKFMFGVNAYSA
DVNNARLNAKCPGMSPQWFGEQVGIKIPEDCNIICVVCKEVGPNEPLTREKLSPVLAILK
AENTQDGIDKAEAMVEFNGRGHSAAIHSNDKAVVEKYALTMKACRILHNTPSSQGGIGSI
YNYIWPSFTLGCGSYGGNSVSANVTYHNLLNIKRLADRRNNLQWFRVPPKIFFEPHSIRY
LAELKELSKIFIVSDRMMYKLGYVDRVMDVLKRRSNEVEIEIFIDVEPDPSIQTVQKGLA
VMNTFGPDNIIAIGGGSAMDAAKIMWLLYEHPEADFFAMKQKFIDLRKRAFKFPTMGKKA
RLICIPTTSGTGSEVTPFAVISDHETGKKYPLADYSLTPSVAIVDPMFTMSLPKRAIADT
GLDVLVHATEAYVSVMANEYTDGLAREAVKLVFENLLKSYNGDLEAREKMHNAATIAGMA
FASAFLGMDHSMAHKVGAAFHLPHGRCVAVLLPHVIRYNGQKPRKLAMWPKYNFYKADQR
YMELAQMIGLKCNTPAEGVEAFAKACEELMKATETITGFKQANIEESAWMSKVPEMALLA
FEDQCSPANPRVPMVKDMEKILKAAYYPIA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacaacaaagtatgactgtagatgaacatattaatcaacttgttgctaaagca
caagttgcacttaaagaatatcttaaaccagaatttacacaagaaaaaatagattatatt
gtaaagaaagcatcagttgcagcacttgaccaacattgtgcacttgcagcagcagcagtt
gaagaaacaggaagaggtatttttgaagataaagctactaagaatatatttgcatgtgaa
catgttacacatgaaatgagacatgctaaaaccgttggtattgttaatgtagatccactt
tatggaattacagaaattgcagaaccagttggagttgtttgtggagttacaccagttact
aatccaacatcaacagctattttcaaatcacttatttcaattaagacaagaaatccaatt
gtattttcattccatccatcagcacttaaatgttcaattatggcagctaaaattgttaga
gatgcagctattgcagcaggagcaccagaaaattgtattcaatggattgaatttggagga
attgaagcatcaaataaattaatgaatcatccaggagttgcaactattcttgcaacagga
ggaaatgctatggtaaaagcagcatattcatcaggaaaaccagcacttggagtaggagca
ggaaatgtaccaacatatattgaaaagacatgtaatattaaacaagcagcaaatgatgta
gttatgtcaaaatcatttgataatggtatgatttgtgcatcagaacaagcagcaattatt
gataaagaaatttatgatcaagtagttgaagaaatgaaaacacttggagcatatttcatt
aatgaagaagaaaaagctaagttagaaaagtttatgtttggagttaatgcatattcagca
gatgttaataatgcaagacttaatgcaaaatgtccaggaatgtcaccacaatggtttgga
gaacaagttggaattaaaataccagaagattgtaatattatttgtgtagtttgtaaagaa
gttggaccaaatgaaccattaacaagagaaaaattatcaccagttcttgctattcttaaa
gcagaaaatacacaagatggaattgataaagcagaagctatggttgaatttaatggtaga
ggacattcagcagctattcattcaaatgataaagcagtagttgaaaaatatgcacttaca
atgaaagcatgtagaattttacataatacaccatcatcacaaggaggaattggatcaatt
tataattatatttggccatcatttacacttggatgtggatcatatggaggaaattcagta
tcagcaaatgttacatatcataatttattaaatattaaaagacttgcagatagaagaaat
aatcttcaatggtttagagtaccaccaaaaatattctttgaaccacattcaattagatat
cttgcagaacttaaagaacttagtaaaatatttattgtatcagatagaatgatgtataaa
ttaggatatgttgatagagttatggatgtattaaaaagaagaagtaatgaagtagaaata
gaaattttcattgatgtagaaccagatccatcaattcaaacagttcaaaaaggacttgct
gttatgaatacatttggaccagataatattattgctattggaggaggatcagctatggat
gcagctaagattatgtggttactttatgaacatccagaagcagatttctttgcaatgaaa
caaaaattcattgatcttagaaagagagcatttaaattcccaacaatgggtaaaaaagct
agattaatttgtattccaacaacatcaggaacaggatcagaagttacaccatttgcagtt
atttcagatcatgaaacaggtaagaaatatccacttgcagattattcacttacaccatca
gttgctattgtagatccaatgtttactatgtcacttccaaagagagcaattgcagataca
ggacttgatgtattagttcatgcaacagaagcatatgtttcagttatggctaatgaatat
acagatggacttgctagagaagcagttaaattagtttttgaaaatcttcttaaatcatat
aatggagatttagaagcaagagaaaaaatgcataatgcagcaacaattgcaggtatggca
tttgcatcagcattccttggtatggatcattcaatggcacataaagtaggagcagcattc
catcttccacatggtagatgtgtagcagtattattaccacatgtcattagatataatgga
caaaaaccaagaaaacttgcaatgtggccaaaatataatttctataaagctgatcaaaga
tatatggaacttgcacaaatgattggacttaaatgtaatacaccagcagaaggagttgaa
gcatttgctaaagcatgtgaagaattaatgaaagctactgaaactattacaggattcaaa
caagcaaatattgaagaatcagcatggatgagtaaagtaccagaaatggcacttcttgca
tttgaagatcaatgttcaccagctaatccaagagtaccaatggttaaggatatggaaaag
attcttaaagctgcttattatccaattgcttga

DBGET integrated database retrieval system