KEGG   Entamoeba dispar: EDI_350300Help
Entry
EDI_350300        CDS       T01083                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
edi  Entamoeba dispar
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EDI_350300
   03420 Nucleotide excision repair
    EDI_350300
   03430 Mismatch repair
    EDI_350300
   03440 Homologous recombination
    EDI_350300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 149 aa AA seqDB search
MAYANLETETTGGFTQSSPRKNVENKNVVFPLTALSFIHTESNNKKQFTYKQVVLNTVVV
CGRITSIDIQNDVKRYTINDSTGSVVVGVYQTDSTEENIEVGQYIKCVGKIKKFSQETYI
LASRLPLVVDVNHMMTHLIECAYALSKLK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgctaatcttgaaactgaaacaactggtggattcacacaaagctcaccaaga
aaaaatgtagaaaataaaaatgttgtgtttcctttaactgcattaagttttattcatact
gaatctaataataaaaaacaattcacatataaacaagttgtattaaatactgttgttgtt
tgtggtagaataacaagtattgacatacaaaatgatgttaaaagatatacgattaatgac
tcaacagggagtgttgttgttggagtatatcaaacagattcaacagaagaaaatattgaa
gttggtcaatatattaaatgtgttggtaaaattaaaaagttttctcaagagacatatata
ttagcatctcgactaccacttgttgttgatgttaatcatatgatgactcatttgattgaa
tgtgcttatgccctttctaaacttaaatga

DBGET integrated database retrieval system