KEGG   Entamoeba dispar: EDI_350300Help
Entry
EDI_350300        CDS       T01083                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
edi  Entamoeba dispar
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:edi03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:edi03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:edi03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:edi03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 149 aa AA seqDB search
MAYANLETETTGGFTQSSPRKNVENKNVVFPLTALSFIHTESNNKKQFTYKQVVLNTVVV
CGRITSIDIQNDVKRYTINDSTGSVVVGVYQTDSTEENIEVGQYIKCVGKIKKFSQETYI
LASRLPLVVDVNHMMTHLIECAYALSKLK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgctaatcttgaaactgaaacaactggtggattcacacaaagctcaccaaga
aaaaatgtagaaaataaaaatgttgtgtttcctttaactgcattaagttttattcatact
gaatctaataataaaaaacaattcacatataaacaagttgtattaaatactgttgttgtt
tgtggtagaataacaagtattgacatacaaaatgatgttaaaagatatacgattaatgac
tcaacagggagtgttgttgttggagtatatcaaacagattcaacagaagaaaatattgaa
gttggtcaatatattaaatgtgttggtaaaattaaaaagttttctcaagagacatatata
ttagcatctcgactaccacttgttgttgatgttaatcatatgatgactcatttgattgaa
tgtgcttatgccctttctaaacttaaatga

DBGET integrated database retrieval system