KEGG   Escherichia coli DH1: ECDH1ME8569_0109Help
Entry
ECDH1ME8569_0109  CDS       T02102                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
edj  Escherichia coli DH1
Pathway
edj00010  Glycolysis / Gluconeogenesis
edj00020  Citrate cycle (TCA cycle)
edj00620  Pyruvate metabolism
edj01100  Metabolic pathways
edj01110  Biosynthesis of secondary metabolites
edj01120  Microbial metabolism in diverse environments
edj01130  Biosynthesis of antibiotics
edj01200  Carbon metabolism
Module
edj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:edj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECDH1ME8569_0109 (aceF)
   00020 Citrate cycle (TCA cycle)
    ECDH1ME8569_0109 (aceF)
   00620 Pyruvate metabolism
    ECDH1ME8569_0109 (aceF)
Enzymes [BR:edj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ECDH1ME8569_0109 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: BAJ41965
Structure
PDB: 

Jmol
Position
125696..127588
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPA
AKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRED
VQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagcacca
gcggctgcggcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgacaaggcttctatggaagttccggctccgtttgctggcaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggccgctaaacaggaagcagctccggcagcggcccct
gcaccagcggctggcgtgaaagaagttaacgttccggatatcggcggtgacgaagttgaa
gtgactgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgatcacc
gtagaaggcgacaaagcttctatggaagttccggcgccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggctcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcggcagctcctgcgaaacaggaagcggcagcgccggcaccggca
gcaaaagctgaagccccggcagcagcaccagctgcgaaagcggaaggcaaatctgaattt
gctgaaaacgacgcttatgttcacgcgactccgctgatccgccgtctggcacgcgagttt
ggtgttaaccttgcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagac
gttcaggcttacgtgaaagaagctatcaaacgtgcagaagcagctccggcagcgactggc
ggtggtatccctggcatgctgccgtggccgaaggtggacttcagcaagtttggtgaaatc
gaagaagtggaactgggccgcatccagaaaatctctggtgcgaacctgagccgtaactgg
gtaatgatcccgcatgttactcacttcgacaaaaccgatatcaccgagttggaagcgttc
cgtaaacagcagaacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggtt
gtcttcatcatgaaagccgttgctgcagctcttgagcagatgcctcgcttcaatagttcg
ctgtcggaagacggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtg
gataccccgaacggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatc
gagctgtctcgcgagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcg
ggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtactacccac
ttcgcgccgattgtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatg
gagccggtgtggaatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctcc
ttcgaccaccgcgtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaac
acgctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system