KEGG   Escherichia coli DH1: ECDH1ME8569_1337Help
Entry
ECDH1ME8569_1337  CDS       T02102                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
edj  Escherichia coli DH1
Pathway
edj00071  Fatty acid degradation
edj00280  Valine, leucine and isoleucine degradation
edj00281  Geraniol degradation
edj00310  Lysine degradation
edj00360  Phenylalanine metabolism
edj00362  Benzoate degradation
edj00380  Tryptophan metabolism
edj00410  beta-Alanine metabolism
edj00627  Aminobenzoate degradation
edj00640  Propanoate metabolism
edj00650  Butanoate metabolism
edj00903  Limonene and pinene degradation
edj00930  Caprolactam degradation
edj01100  Metabolic pathways
edj01110  Biosynthesis of secondary metabolites
edj01120  Microbial metabolism in diverse environments
edj01130  Biosynthesis of antibiotics
edj01212  Fatty acid metabolism
Module
edj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:edj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECDH1ME8569_1337 (paaF)
   00650 Butanoate metabolism
    ECDH1ME8569_1337 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ECDH1ME8569_1337 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECDH1ME8569_1337 (paaF)
   00310 Lysine degradation
    ECDH1ME8569_1337 (paaF)
   00360 Phenylalanine metabolism
    ECDH1ME8569_1337 (paaF)
   00380 Tryptophan metabolism
    ECDH1ME8569_1337 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECDH1ME8569_1337 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECDH1ME8569_1337 (paaF)
   00281 Geraniol degradation
    ECDH1ME8569_1337 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECDH1ME8569_1337 (paaF)
   00627 Aminobenzoate degradation
    ECDH1ME8569_1337 (paaF)
   00930 Caprolactam degradation
    ECDH1ME8569_1337 (paaF)
Enzymes [BR:edj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECDH1ME8569_1337 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAJ43193
Structure
PDB: 

Jmol
Position
1439679..1440446
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system