KEGG   Escherichia coli DH1: ECDH1ME8569_1712Help
Entry
ECDH1ME8569_1712  CDS       T02102                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
edj  Escherichia coli DH1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:edj00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1835268..1835909
Genome map
AA seq 213 aa AA seqDB search
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLHQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtgccggaaggtgacagtacggtggatgtcgctaaccgcctgattgactggtgc
cagtcgcgcggtgaagcggttatcgccagtcaggactggcacccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccaggccaactcgacggtttgccacaa
accttctggccagatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
caccaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaacctctctcgatgactggttacgcgat
catgaaatcgatgaattgatcgttatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggttataaggtaaacgtgattaccgatggttgtcgtggc
gtgaatatccagccccaggacagtgcgcacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagagacacaggggtaa

DBGET integrated database retrieval system