KEGG   Escherichia coli DH1: ECDH1ME8569_2397Help
Entry
ECDH1ME8569_2397  CDS       T02102                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
edj  Escherichia coli DH1
Pathway
edj00300  Lysine biosynthesis
edj01100  Metabolic pathways
edj01120  Microbial metabolism in diverse environments
edj01230  Biosynthesis of amino acids
Module
edj_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:edj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ECDH1ME8569_2397 (dapE)
Enzymes [BR:edj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ECDH1ME8569_2397 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: BAJ44253
Position
2569698..2570825
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQNFWAWRGQGET
LAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacaacagcttattcgccgcccttccctgagtcct
gatgatgcaggatgccaggctttgttgattgaacgtttgcaggcgatcggttttaccgtt
gaacgcatggactttgccgatacgcagaatttttgggcatggcgtgggcagggtgaaacg
ttagcctttgccgggcataccgacgtggtgccgcctggcgacgccgatcgttggatcaat
cccccgtttgaacccaccattcgtgacggcatgttattcgggcgcggtgcggcagatatg
aaaggctcgctggcggcgatggtggtggcggcagaacgttttgtcgcacaacatcccaac
catacggggcgactggcatttctgatcacctctgatgaagaagccagtgcccacaacggt
acggtaaaagtcgtcgaagcgttaatggcacgtaatgagcgtctcgattactgcctggtt
ggcgaaccgtcgagtatcgaagtggtaggtgatgtggtgaaaaatggtcgtcgcggatca
ttaacctgcaaccttaccattcatggcgttcaggggcatgttgcctacccacatctggct
gacaatccggtacatcgcgcagcacctttccttaatgaattagtggctattgagtgggat
cagggcaatgaattcttcccggcgaccagtatgcagattgccaatattcaggcgggaacg
ggcagtaacaacgttattccgggtgaactgtttgtgcagtttaacttccgcttcagcacc
gaactgactgatgagatgatcaaagcgcaggtgcttgccctgcttgaaaaacatcaactg
cgctatacggtggattggtggctttccgggcagccatttttgaccgcgcgcggtaaactg
gtggatgcggtcgttaacgcggttgagcactataatgaaattaaaccgcagctactgacc
acaggcggaacgtccgacgggcgctttattgcccgcatgggggcgcaggtggtggaactc
gggccggtcaatgccactattcataaaattaatgaatgtgtgaacgctgccgacctgcag
ctacttgcccgtatgtatcaacgtatcatggaacagctcgtcgcctga

DBGET integrated database retrieval system