KEGG   Escherichia coli DH1: ECDH1ME8569_3700Help
Entry
ECDH1ME8569_3700  CDS       T02102                                 

Gene name
pldA
Definition
(GenBank) phospholipase A1 precursor
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
edj  Escherichia coli DH1
Pathway
edj00564  Glycerophospholipid metabolism
edj00565  Ether lipid metabolism
edj00590  Arachidonic acid metabolism
edj00592  alpha-Linolenic acid metabolism
edj01100  Metabolic pathways
edj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:edj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECDH1ME8569_3700 (pldA)
   00565 Ether lipid metabolism
    ECDH1ME8569_3700 (pldA)
   00590 Arachidonic acid metabolism
    ECDH1ME8569_3700 (pldA)
   00591 Linoleic acid metabolism
    ECDH1ME8569_3700 (pldA)
   00592 alpha-Linolenic acid metabolism
    ECDH1ME8569_3700 (pldA)
Enzymes [BR:edj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ECDH1ME8569_3700 (pldA)
    3.1.1.32  phospholipase A1
     ECDH1ME8569_3700 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: BAJ45556
Structure
PDB: 

Jmol
Position
3983967..3984836
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atttacacccaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttccgacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggggttatgctaaacgatttgttttga

DBGET integrated database retrieval system