KEGG   Escherichia coli DH1: ECDH1ME8569_3785Help
Entry
ECDH1ME8569_3785  CDS       T02102                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
edj  Escherichia coli DH1
Pathway
edj00010  Glycolysis / Gluconeogenesis
edj00030  Pentose phosphate pathway
edj00051  Fructose and mannose metabolism
edj00052  Galactose metabolism
edj00680  Methane metabolism
edj01100  Metabolic pathways
edj01110  Biosynthesis of secondary metabolites
edj01120  Microbial metabolism in diverse environments
edj01130  Biosynthesis of antibiotics
edj01200  Carbon metabolism
edj01230  Biosynthesis of amino acids
edj03018  RNA degradation
Module
edj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:edj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECDH1ME8569_3785 (pfkA)
   00030 Pentose phosphate pathway
    ECDH1ME8569_3785 (pfkA)
   00051 Fructose and mannose metabolism
    ECDH1ME8569_3785 (pfkA)
   00052 Galactose metabolism
    ECDH1ME8569_3785 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ECDH1ME8569_3785 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECDH1ME8569_3785 (pfkA)
Enzymes [BR:edj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECDH1ME8569_3785 (pfkA)
Protein phosphatases and associated proteins [BR:edj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECDH1ME8569_3785 (pfkA)
Messenger RNA biogenesis [BR:edj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECDH1ME8569_3785 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAJ45641
Structure
PDB: 

Jmol
Position
4086657..4087619
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggtatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtgtctgac
atgatcaaccgtggcggtacgttcctcggttctgcgcgtttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtggtatcgacgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggtctgccgggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggagatctgacgttggct
gcggccattgccggtggctgtgaattcgttgtggttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggttac
ggcggtcgttgtgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system