KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00054Help
Entry
EcWSU1_00054      CDS       T01652                                 

Gene name
gmuD
Definition
6-phospho-beta-glucosidase gmuD
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_00054 (gmuD)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EcWSU1_00054 (gmuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(50736..52118)
Genome map
AA seq 460 aa AA seqDB search
MKYAFPDNFWWGSASSALQTEGTREGETTWDYWFAREPNRFHNGVGPQHTSTFYQHWKTD
IQLLKQLNHNSFRTSISWARLIPDGIGEVNPEAVNFYHQVIDELIEQGITPFITLFHFDM
PMAMQEIGGWENRNVVDAYARYAQICFELFGDRVLHWFTFNEPIVPVEGGYLYDFHYPNV
VDFRRAATVAYHTVLAHAQAVRAYRAGHYAGEIGIVLNLTPSYPRSQNPADVKAAHIADL
MFNRSFLDPVLRGEYPADLVALLKSYDQLPACKPEDSFLIAEGKIDLLGINYYQPRRVKC
RDSAVNPQAPFMPEWFFDNYEMPGRKMNPYRGWEIYEPGIYDILINLRDNYGNPRCFISE
NGMGVENEQRFIENGQINDQYRIDFISEHLAWLHKGISEGCQCLGYHMWTFIDNWSWCNA
YKNRYGFIQLNLTTQQRTIKKSGEWFAATALNNSFDRESV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgcatttcccgataatttctggtggggcagcgcaagctccgccctccagacc
gaagggacacgagagggtgaaaccacctgggattactggtttgcccgcgagccgaaccgt
tttcataatggcgtgggaccgcagcacacctccacgttttatcaacactggaaaacagac
attcagctgttaaagcagctgaaccacaacagctttcgcacctcgattagctgggcgcgc
ctgatccccgacggtatcggtgaagtgaacccggaagcggtcaatttttatcatcaggtc
attgatgagttgattgaacagggtattaccccgtttatcaccctgttccacttcgacatg
ccgatggcgatgcaggagattggcggctgggaaaaccgcaacgtggtggacgcttacgcc
cgttatgcgcagatttgcttcgagctgtttggcgatcgcgtgctgcactggtttaccttc
aacgagccgattgtgccggtggaaggcggctatctgtacgatttccactatcccaacgtg
gtggattttcgtcgtgcggccaccgtggcgtatcacaccgtgctggcgcatgcgcaggcg
gtacgcgcttaccgtgccgggcactacgccggggagatcggtatcgtactgaacctgacg
ccgtcctatccgcgctcgcaaaacccggctgacgtcaaagcggcacacattgcggacctg
atgtttaaccgcagcttccttgaccccgtcctgcgcggtgaatacccggcggatctggtg
gcgttgctgaaatcttacgatcagctccccgcctgcaaaccggaagacagtttcctgatt
gcggaaggaaaaatcgacctgctcggcattaactattatcagccgcgtcgcgtgaaatgc
cgtgacagtgcggtgaacccacaggcaccgtttatgccggagtggttctttgataattac
gaaatgcctggtcgcaagatgaatccataccgtggctgggaaatttatgagccgggtatt
tacgatattctgattaacctgcgcgacaattacggtaacccacgctgttttatttctgag
aacggtatgggtgtcgaaaatgaacagcgctttattgagaatggtcagataaacgatcaa
taccgcatcgattttatttccgaacatttggcctggctgcataaaggtattagcgaaggg
tgccagtgtcttggctaccatatgtggacctttattgataactggtcgtggtgtaatgcg
tataaaaatcgctacggatttatccagctcaatttaactacccagcagcgcaccatcaag
aaaagcggcgagtggtttgccgccaccgcattaaataacagttttgacagagagtcagtg
taa

DBGET integrated database retrieval system