KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00106Help
Entry
EcWSU1_00106      CDS       T01652                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:eec03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101747..102586
Genome map
AA seq 279 aa AA seqDB search
MHSASYSGGTMPELPEVETSRRGIEPHLVGATILHAIVRNGRLRWPVSDEIHALSDKPIL
SVQRRAKYLLLELPDGWIIIHLGMSGSLRILTEELPAEKHDHVDLVMSNGKVLRYTDPRR
FGAWLWTKELEGHSVLAHLGPEPLSEAFNAEYLKAKCAKKKTPIKPWLMDNKLVVGVGNI
YASESLFAAGIHPDRLASSLSSQECELLVRVIKAVLLRSIEQGGTTLKDFLQSDGKPGYF
AQELQVYGRKGEPCRVCGTPIIATKHAQRATFYCRQCQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgcattctgcatcttactccggaggaaccatgcctgaattacctgaggtagagaccagc
cgccgcggtattgagccgcatctggtcggcgcgactattcttcatgctatcgttcgcaac
ggtcgcctgcgttggccggtgtccgatgaaatccatgcgttaagcgataaaccgattctc
agcgtccagcgtcgcgccaaatatctgctgctggagctgcccgacggctggattatcatc
catctcggtatgtccggtagtctgcgcatccttaccgaagaactgcccgcggaaaagcat
gaccatgtcgatctggtgatgagcaacggtaaagtgctgcgttacaccgacccacgacgc
tttggcgcatggctgtggaccaaagagcttgaaggacacagcgttctggcgcatctgggg
ccagagccgctttctgaggcgtttaacgcggaatacctgaaagcgaagtgtgcaaagaag
aaaactccgatcaaaccgtggctgatggacaataagctggtggtgggagtagggaatatt
tatgccagcgaatcgctgtttgccgccgggatccatcccgatcggctggcctcatcgctg
tcatctcaggagtgtgaactgctggtccgggtgattaaagcggtgctgttgcgttctatt
gagcaaggggggaccaccctgaaggacttcctgcagagcgacggtaaacccggctatttt
gcccaggagctgcaggtatatggccgtaagggtgagccgtgcagagtctgtgggacaccg
attattgcaacgaagcacgctcagcgcgccacgttctattgccgtcagtgccagaaatag

DBGET integrated database retrieval system