KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00233Help
Entry
EcWSU1_00233      CDS       T01652                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcWSU1_00233 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcWSU1_00233 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    EcWSU1_00233 (aceB)
Enzymes [BR:eec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EcWSU1_00233 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243289..244908
Genome map
AA seq 539 aa AA seqDB search
MMRSRVMTQQATTVDELAFTQPHGEQEQQILTADAVEFLTELVTRFTPTRNKLLAARIHQ
QQEIDDGKLPGFISETASIRRGEWKIRGIPDDLQDRRVEITGPVERKMVINAMNANVKVF
MADFEDSLAPDWHKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPE
KHVTWRGEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAVWWSEVFSFTED
RFNLPRGTIKATLLIETLPAVFQMNEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRV
LPDRQVVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKE
LEARNGHDGTWIAHPGLADTAMDVFNRVLGENKNQLFVTRDEDAPTAEEHLLAPCAGERT
EEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPV
TKSLFRQMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRFLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaggagcagagtaatgactcaacaggcaacgacggtcgatgaactggcctttacc
cagccgcatggcgagcaagaacagcaaattttgacagcagacgctgtcgaattcctgacc
gaactggtgacccgctttacgccaacgcgcaataagctgctggcggcacgcattcatcag
cagcaggaaattgatgatggcaagttgcctgggtttatttcggaaaccgcttccattcgc
cgtggtgagtggaaaatccgcggcattccggatgatttacaggatcggcgcgtcgaaatc
accggcccggtggagcgcaaaatggtgatcaacgccatgaacgcgaacgtaaaagtcttt
atggcagattttgaggactcactggcgccggactggcataaggttatcgacgggcaaatc
aatctgcgcgatgccgtaaatggcaccatcagctataccaacgaagccggcaaaatctat
caactgaaacccaatccggcggttctgatctgtcgcgtacgtggactgcatctgcctgaa
aagcatgtcacctggcgcggcgaagccattccgggcagtctgtttgacttcgccctctat
ttcttccacaaccacaagaatctgctggcaaaaggcagcggcccctatttctatctgccg
aaaacacaggcctggcaggaagcggtctggtggagtgaagtgtttagcttcacggaagat
cgtttcaacctgccgcgcggcaccattaaagccaccctgctgattgaaacgctgcctgcc
gtgttccagatgaacgaaattctgcatgcgctgcgcgaccatattgttgggctgaactgt
ggacgctgggattacatcttcagctacatcaaaaccctgaaaaatcatcccgatcgtgta
ctgccggatcgccaggtggtcaccatggataaaccgttcctgagtgcctactcacgcctg
ttgattaagacctgccacaagcgtggggcctttgcgatggggggaatggcggcatttatc
ccaagcaaagatgctgaacgtaacaatcaggtgctcaacaaggtgaaagccgataaagag
cttgaagcacgaaatggccatgacggaacgtggatcgcgcatccgggtctggcggatacg
gcaatggacgtcttcaaccgcgtactcggtgagaacaaaaaccagctgtttgtgacgcgt
gatgaggatgccccaacggctgaagaacacctgctggcaccgtgtgcgggcgagcgtacg
gaagagggcatgcgcgccaatatccgcgtagccgtccagtacattgaagcgtggatctcc
ggtaacggctgcgtgccgatatacggcctgatggaagatgccgctaccgccgaaatctct
cgcacctcaatctggcagtggatccaccatcaaaaaacgctcagcaacggcaagccggtg
accaaatccctgttccgtcagatgctggccgaagagatgcgggtgatccaggacgaactg
ggtgaacaccgcttcagcagcggacgttttgatgacgccgcacgcctgatggagcaaatc
accacatccgatgacttaatcgacttcctgaccctgccgggctaccgcttcctggcgtaa

DBGET integrated database retrieval system