KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00233Help
Entry
EcWSU1_00233      CDS       T01652                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eec01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eec00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eec00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243289..244908
Genome map
AA seq 539 aa AA seqDB search
MMRSRVMTQQATTVDELAFTQPHGEQEQQILTADAVEFLTELVTRFTPTRNKLLAARIHQ
QQEIDDGKLPGFISETASIRRGEWKIRGIPDDLQDRRVEITGPVERKMVINAMNANVKVF
MADFEDSLAPDWHKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPE
KHVTWRGEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAVWWSEVFSFTED
RFNLPRGTIKATLLIETLPAVFQMNEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRV
LPDRQVVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKE
LEARNGHDGTWIAHPGLADTAMDVFNRVLGENKNQLFVTRDEDAPTAEEHLLAPCAGERT
EEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPV
TKSLFRQMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRFLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaggagcagagtaatgactcaacaggcaacgacggtcgatgaactggcctttacc
cagccgcatggcgagcaagaacagcaaattttgacagcagacgctgtcgaattcctgacc
gaactggtgacccgctttacgccaacgcgcaataagctgctggcggcacgcattcatcag
cagcaggaaattgatgatggcaagttgcctgggtttatttcggaaaccgcttccattcgc
cgtggtgagtggaaaatccgcggcattccggatgatttacaggatcggcgcgtcgaaatc
accggcccggtggagcgcaaaatggtgatcaacgccatgaacgcgaacgtaaaagtcttt
atggcagattttgaggactcactggcgccggactggcataaggttatcgacgggcaaatc
aatctgcgcgatgccgtaaatggcaccatcagctataccaacgaagccggcaaaatctat
caactgaaacccaatccggcggttctgatctgtcgcgtacgtggactgcatctgcctgaa
aagcatgtcacctggcgcggcgaagccattccgggcagtctgtttgacttcgccctctat
ttcttccacaaccacaagaatctgctggcaaaaggcagcggcccctatttctatctgccg
aaaacacaggcctggcaggaagcggtctggtggagtgaagtgtttagcttcacggaagat
cgtttcaacctgccgcgcggcaccattaaagccaccctgctgattgaaacgctgcctgcc
gtgttccagatgaacgaaattctgcatgcgctgcgcgaccatattgttgggctgaactgt
ggacgctgggattacatcttcagctacatcaaaaccctgaaaaatcatcccgatcgtgta
ctgccggatcgccaggtggtcaccatggataaaccgttcctgagtgcctactcacgcctg
ttgattaagacctgccacaagcgtggggcctttgcgatggggggaatggcggcatttatc
ccaagcaaagatgctgaacgtaacaatcaggtgctcaacaaggtgaaagccgataaagag
cttgaagcacgaaatggccatgacggaacgtggatcgcgcatccgggtctggcggatacg
gcaatggacgtcttcaaccgcgtactcggtgagaacaaaaaccagctgtttgtgacgcgt
gatgaggatgccccaacggctgaagaacacctgctggcaccgtgtgcgggcgagcgtacg
gaagagggcatgcgcgccaatatccgcgtagccgtccagtacattgaagcgtggatctcc
ggtaacggctgcgtgccgatatacggcctgatggaagatgccgctaccgccgaaatctct
cgcacctcaatctggcagtggatccaccatcaaaaaacgctcagcaacggcaagccggtg
accaaatccctgttccgtcagatgctggccgaagagatgcgggtgatccaggacgaactg
ggtgaacaccgcttcagcagcggacgttttgatgacgccgcacgcctgatggagcaaatc
accacatccgatgacttaatcgacttcctgaccctgccgggctaccgcttcctggcgtaa

DBGET integrated database retrieval system