KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00234Help
Entry
EcWSU1_00234      CDS       T01652                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcWSU1_00234 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EcWSU1_00234 (aceA)
Enzymes [BR:eec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EcWSU1_00234 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244925..246244
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQRGAAKMWD
LLHGGAKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPTVVDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDA
DAADLITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ALAKRFADAIHAKYPGKLLAYNCSPSFNWQKKLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDNVTTII
QGGTSSVTALTGSTEEAQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacaaatcgaagaattgaagaaagagtgg
acccaacctcgctgggaaggcatccgccgcccgtatagcgcggaagaggtggtgaaattg
cgtggctcggtcaatccggaatgtaccctggcgcagcgcggcgcggcgaaaatgtgggat
ctgctgcacggcggtgccaaaaaaggttacatcaatagcctcggcgcgctgactggcggc
caggccctgcagcaggcgaaagccggcatcgaagccatctatctttccggctggcaggtt
gcggcggacgccaacctggcctccagcatgtatccggatcagtcgctctatccggcaaac
tcggtaccaaccgtggtggatcggatcaacaacaccttccgccgtgcggatcagatccag
tgggcggcaggcattgagccaaacgatccgcgttttattgactattttctgccaatcgtc
gcggatgcggaagcgggattcggcggcgtgctgaacgcctttgagctgatgaaatcgatg
attgaggccggtgcagcggccgttcacttcgaagaccagctcgcgtcagtgaagaaatgc
ggacacatgggcgggaaagtccttgtcccaacccaggaagcgattcagaagctggttgcg
gcgcgtctggcggctgacgtgctcggcgtacccacgctggtgattgcccgtaccgatgcg
gatgcggctgacctgatcacttctgactgcgatccttacgacagcgagttcattaccggt
gaacgcaccagcgaagggttttatcgtacccatgctggcattgaacaggcgatcagccgt
gggctggcatatgcaccgtatgcggacctggtctggtgcgaaacctccacgccggacctg
gcgctggcaaaacgctttgccgatgctatccacgccaaatatccgggcaaactgctggcc
tataactgctcgccgtccttcaactggcagaagaaactggacgataaaaccatcgccagc
ttccagcagcaactgtccgacatgggctacaaatatcagttcatcacgctggctggcatt
cacagcatgtggttcaacatgttcgacctggcgcatgcctacgcgcagggtgaaggcatg
aagcattacgttgagaaggtgcagcagccggaatttgctgccggtaaagagggctatacc
ttcgtttcgcatcagcaggaggtcgggaccggttacttcgataacgtgaccactatcatc
caggggggcacctcctccgtcaccgccttaacgggatcgacggaagaagcccagttctga

DBGET integrated database retrieval system