KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00294Help
Entry
EcWSU1_00294      CDS       T01652                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00010  Glycolysis / Gluconeogenesis
eec00620  Pyruvate metabolism
eec00640  Propanoate metabolism
eec00680  Methane metabolism
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
eec01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_00294 (acs)
   00620 Pyruvate metabolism
    EcWSU1_00294 (acs)
   00640 Propanoate metabolism
    EcWSU1_00294 (acs)
  Energy metabolism
   00680 Methane metabolism
    EcWSU1_00294 (acs)
Enzymes [BR:eec01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EcWSU1_00294 (acs)
Lipid biosynthesis proteins [BR:eec01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EcWSU1_00294 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEW71734
UniProt: G8LHM4
Position
complement(310559..312517)
Genome map
AA seq 652 aa AA seqDB search
MSQVHKHDIPANIADRCLINPEQYHEKYQQSVSSPDVFWGEQGHILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLAERGNETAIIWEGDDASQSKHITYKELHRDVCRF
ANVLLERGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIVDSSS
KLVITADEGVRAGRGIPLKKNVDEALKNPNVKTVSNVIVLKRTGGKIDWNEGRDLWWSDL
IEKASDQHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPMPGATQLKAGSATQPFFGVQPALVDNEGHPLDGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQSIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtacataaacacgacattcccgcaaacattgcggaccgttgcctgataaac
ccggagcagtaccacgagaagtatcagcaatccgtctccagcccggacgtcttctggggt
gagcagggccatattcttgactggattaaaccttatcagaaggtgaagaacacctccttt
gcgcccggcaacgtctccattaaatggtacgaagacggcacgctgaacctggcagcaaac
tgtcttgaccgccaccttgccgaacgcggtaatgaaacggccattatctgggagggcgac
gacgcctctcaaagcaaacacattacttataaagaactgcaccgcgacgtgtgccgcttt
gccaacgttctgctggaaaggggcattaaaaaaggcgacgtggtggctatctatatgcca
atggtgcctgaagcggcggtagccatgctggcctgcgcgcgtatcggtgcgattcactcg
gtgatttttggcggcttctcaccggaagcggtagccggacgtattgtcgattccagctcg
aaactggtgatcacggccgatgaaggcgtgcgcgctggccgtggcattcccctgaagaaa
aacgtcgatgaagcgctgaaaaatccgaacgtgaaaaccgtcagcaacgtcatcgtcctc
aagcgtaccggcggcaagattgactggaacgaaggacgcgacctgtggtggagcgatctg
attgaaaaagccagcgaccagcatcagccggaagagatgaacgcggaagacccgctgttt
attctttacacctccggctcaaccggcaaaccgaaaggcgtgctgcacaccaccggcggc
tatctggtctatgccgctaccaccttcaagtacgtattcgactaccatccgggcgacatt
tactggtgtactgccgacgtaggttgggtcaccggtcacagctacctgctttacggcccg
ctggcctgtggtgccactacgctgatgtttgaaggcgtaccgaactggccaacgccggca
cgcatgtgtcaggtggtcgacaaacacaaggtcaatattctctataccgccccaacggcg
atccgcgcattaatggcggaaggcgataaggccattgaaggcactgaccgctcttcgctg
cgcatcctcggttccgttggcgagcccatcaacccggaagcctgggagtggtactggaag
aaaatcggcaacgaaaaatgtccggtaatggacacctggtggcagaccgaaaccggcggc
tttatgatcacccctatgccgggtgcgacgcagttaaaagccggttcagcaactcaaccg
ttcttcggcgtacaacctgcgctggtggataacgaaggtcatccgctggacggggccacc
gaaggcaatctggtgatcaccgattcctggccgggccaggcgcgtaccctgttcggcgac
cacgagcgctttgagcagacctacttctcgacctttaaaaacatgtactttagcggtgac
ggcgcccgacgtgacgaggacggttattactggataaccgggcgcgtggacgacgtgctt
aacgtctccggccaccgtctgggtaccgcggagattgaatccgcgctggtatctcatccg
aagatcgccgaagccgccgtcgtcgggatcccacacaacattaaaggccaggcgatttac
gcctacgtcacgctgaatcatggcgaagagccgtcaccagagctgtatgccgaggtgcgc
aactgggtacgtaaagagattggcccgcttgccacgccggacgtgctgcactggaccgac
tctctgccgaaaacccgctcaggcaaaattatgcgccgcatattgcgcaaaatcgcagcc
ggtgacaccagcaacctcggtgatacctcaacgcttgccgatcctggcgtggtggaaaaa
ctgctcgaagagaagcagtccatcgcaatgccatcgtaa

DBGET integrated database retrieval system