KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00409Help
Entry
EcWSU1_00409      CDS       T01652                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    EcWSU1_00409 (cysQ)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     EcWSU1_00409 (cysQ)
Transfer RNA biogenesis [BR:eec03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    EcWSU1_00409 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434778..435518
Genome map
AA seq 246 aa AA seqDB search
MLDKICQLARDAGDAIMQVYDGAKPMEVVSKADDSPVTAADIAAHKVILQGLQALTPDIP
VLSEEAPQSWDERQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEKGKAVLGVVYAPVM
KVMYSAADGKAWKEECGVRKQIQVRDARPPLVVISRSHSDSELQEYLQQLGEHQTTSIGS
SLKFCLVAEGHAQLYPRFGPTNVWDTAAGHAVATAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagataagatttgtcagctcgcacgggatgcgggagatgccatcatgcaggtgtat
gacggtgcaaaaccgatggaggtcgtcagcaaggctgatgactctccggtcaccgcggca
gatatcgcggctcacaaggtgatcctgcaagggctgcaggccttaacgccggatatcccg
gtcctgtcagaagaagcgccgcagagctgggacgagcgtcagcactggcagcgttactgg
ctggtggaccccctcgacggcaccaaagagtttatcaagcgtaacggtgagttcaccgtc
aacatcgcgctgattgaaaaaggcaaagcggtgcttggggtggtatacgcgccggtgatg
aaagtcatgtacagcgctgcagacggtaaggcgtggaaggaagagtgcggcgtgcgtaag
cagattcaggtgcgcgatgcgcgtccaccgctggtggtgatcagccggtcgcacagcgac
agcgaactgcaggaatatctgcaacagctgggtgaacaccagacgacctcgattggttca
tcactgaaattctgtctggtggcggaaggccatgcccagctctatcctcgctttgggcca
acgaacgtctgggataccgcggcagggcatgcggtcgccacggcagccggggcacatgtt
catgactggcagggtaagccgctggactacaccccgcgcgaatccttccttaaccccggc
ttccgcgtctctatttattga

DBGET integrated database retrieval system