KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00409Help
Entry
EcWSU1_00409      CDS       T01652                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:eec00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434778..435518
Genome map
AA seq 246 aa AA seqDB search
MLDKICQLARDAGDAIMQVYDGAKPMEVVSKADDSPVTAADIAAHKVILQGLQALTPDIP
VLSEEAPQSWDERQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEKGKAVLGVVYAPVM
KVMYSAADGKAWKEECGVRKQIQVRDARPPLVVISRSHSDSELQEYLQQLGEHQTTSIGS
SLKFCLVAEGHAQLYPRFGPTNVWDTAAGHAVATAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagataagatttgtcagctcgcacgggatgcgggagatgccatcatgcaggtgtat
gacggtgcaaaaccgatggaggtcgtcagcaaggctgatgactctccggtcaccgcggca
gatatcgcggctcacaaggtgatcctgcaagggctgcaggccttaacgccggatatcccg
gtcctgtcagaagaagcgccgcagagctgggacgagcgtcagcactggcagcgttactgg
ctggtggaccccctcgacggcaccaaagagtttatcaagcgtaacggtgagttcaccgtc
aacatcgcgctgattgaaaaaggcaaagcggtgcttggggtggtatacgcgccggtgatg
aaagtcatgtacagcgctgcagacggtaaggcgtggaaggaagagtgcggcgtgcgtaag
cagattcaggtgcgcgatgcgcgtccaccgctggtggtgatcagccggtcgcacagcgac
agcgaactgcaggaatatctgcaacagctgggtgaacaccagacgacctcgattggttca
tcactgaaattctgtctggtggcggaaggccatgcccagctctatcctcgctttgggcca
acgaacgtctgggataccgcggcagggcatgcggtcgccacggcagccggggcacatgtt
catgactggcagggtaagccgctggactacaccccgcgcgaatccttccttaaccccggc
ttccgcgtctctatttattga

DBGET integrated database retrieval system