KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00583Help
Entry
EcWSU1_00583      CDS       T01652                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00230  Purine metabolism
eec00240  Pyrimidine metabolism
eec01100  Metabolic pathways
eec03030  DNA replication
eec03430  Mismatch repair
eec03440  Homologous recombination
Module
eec_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EcWSU1_00583 (holD)
   00240 Pyrimidine metabolism
    EcWSU1_00583 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EcWSU1_00583 (holD)
   03430 Mismatch repair
    EcWSU1_00583 (holD)
   03440 Homologous recombination
    EcWSU1_00583 (holD)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EcWSU1_00583 (holD)
DNA replication proteins [BR:eec03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EcWSU1_00583 (holD)
DNA repair and recombination proteins [BR:eec03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     EcWSU1_00583 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: AEW72023
UniProt: G8LL58
Position
611064..611477
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPTALQGEIAISIPAHVRLVMVAEELPALNEPLIGDVLRS
LKLTTEQVLQLTPDRVTMLPSDSRCNSWRMGDIDEVSLEGSQICSPALDELKANPKARSA
LWQQICEYEHDFFPHDA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttgcagcaactgggcatcacccagtgggccttgcgt
cgcccgacggcgttgcagggcgaaatcgccatctccatccctgcgcacgtccggctggtg
atggtggcggaggaactgcctgccctgaatgaaccccttattggtgatgtccttcgtagc
ctgaagctgaccactgaacaggttttacagcttacgccagacagggtcaccatgctgcca
tccgacagccgctgcaacagctggcgtatgggagacatcgatgaggtctccctggaaggg
agccagatctgctcgccagcgctggacgaactgaaagccaacccaaaagcgcgcagcgcg
ctatggcaacaaatctgcgaatatgaacacgatttcttccctcacgacgcctga

DBGET integrated database retrieval system