KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00594Help
Entry
EcWSU1_00594      CDS       T01652                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00240  Pyrimidine metabolism
eec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EcWSU1_00594 (deoA)
Enzymes [BR:eec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     EcWSU1_00594 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AEW72034
UniProt: G8LL69
Position
620906..622228
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDHRFRDIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLLDVTMALCVEMLISGKLASDDADARAKL
QAVLDNGKAAEIFGRMVAAQKGPTDFVEHYAKYLPTATLSKAVYADTEGFVSAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSVDGQRPLAVIHAKDEASWQEAAKAVKAA
ITLDDKAPQSTPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcattaagcgacgaa
gagatccgcttctttatcaatggcattcgtgataacaccatctctgaagggcagattgct
gctctggcgatgaccattttcttccacgatatgtcgatgcctgagcgtgtatcgctgacc
atggcgatgcgagattcaggaaccgttctggactggaaaagcctgaacctcaacggccca
attgtggataaacactcaaccggcggtgttggtgacgtgacgtcgctgatgctgggccca
atggtggcggcctgtggtggttatatccccatgatctccgggcgtggcctgggacatacc
ggcggtacgctcgacaaactggaagccatcccgggcttcgatatcttcccggatgaccat
cgcttccgcgacattattaaagacgttggtgtggcgattatcggccagaccagctctctt
gctcctgcagacaagcgcttctacgcgacccgcgatatcaccgcgaccgtcgactctatt
cccctgattaccgcctctatcctcgccaagaaactggcggaaggcctggatgcgctggtc
atggatgtgaaagtgggcagcggcgcctttatgccgacctatgagctttccgcggcgctg
gcagaagccattgtgggcgtctccaacggtgcgggcgtgcgtactaccgccctgctgacg
gacatgaaccaggtgctggcgtccagcgcaggcaacgctgtggaagtgcgtgaagccgtg
cagttcctcaccggtgaataccggaacccgcgtctgctcgatgtcaccatggccctgtgc
gtggagatgctgatctccggcaagctcgccagcgatgatgccgacgcacgcgccaaactt
caggcggtgctggataacggcaaagcggcagagatcttcggccgcatggtagcggcgcag
aaaggcccgaccgacttcgtggaacactacgcgaaatacctgccaacggcgacgctcagc
aaagcggtctacgccgataccgaaggctttgtctcggcgatggatacgcgcgcgctcggc
atggcggtcgtgtcgatgggcggcggtcgtcgtcaggcctcggacaccattgattacagc
gtcggctttaccgatatggcgcgtctgggtgacagcgtcgatggtcaacgtccgctggcc
gtgatccacgcgaaagatgaagccagctggcaggaagcggcaaaggcggtgaaagcggcc
attacgcttgatgataaagcaccgcaaagcacaccgactgtctatcgccgtatcaccgaa
tag

DBGET integrated database retrieval system