KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00663Help
Entry
EcWSU1_00663      CDS       T01652                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eec00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:eec00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691923..692402
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRTTLNKPVVMGRLTWESIGRPLPGRKNI
VISSQPGTDDRVEWVKSVDEAIAACGNAEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcagcgctggcggtggaccgtgttatcggtatggaaaatgccatg
ccgtggaacctgcctgccgatctcgcatggtttaaacgtactacgttaaacaagccggta
gtgatgggccgcctgacctgggagtcgattggtcgtccattaccgggccgtaaaaatatc
gttatcagtagccagcctggcactgacgatcgcgtcgaatgggtgaagtccgtagacgag
gccattgccgcatgcggtaatgccgaagagatcatggtgattggcggtgggcgtgtgtac
gaacagttcctgccgaaagcacagaagctgtatctgacccacattgatgcggaagtggaa
ggggatacgcatttcccggactacgatcctgatgagtgggaatctgtcttcagtgaattc
cacgacgcggatgcgcagaactcccacagctactgcttcgaaattctggaacgtcgctaa

DBGET integrated database retrieval system