KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00698Help
Entry
EcWSU1_00698      CDS       T01652                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eec00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eec00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
733646..735133
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPNAPERALREMVLDSRAAASGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDRLRLVGVTGTNGK
TTTTQLMAQWAQLLGETGAVMGTVGNGLLGKVSPTENTTGSAVDVQHVLAGLAGQGATFA
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSTHHSGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKAVAVDYHDSGATIRFSSSWGDGEIE
SRLMGAFNVSNLLLALATLLALGYPMNALLETAERLQPVCGRMEVFSAPGKPTVVVDYAH
TPDALEKALEAARLHCTGKLWCVFGCGGDRDKGKRPLMGAIAEQFADIPVVTDDNPRTEE
PRAIINDILSGMLDAGRARVVEGRAEAVTNAIMQAQENDVVLLAGKGHEDYQIVGNRRLD
YSDRVTAARLLGVVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttctcgctccgtgggtgcctaatgcaccggagcga
gcactgcgagagatggtactggacagccgtgcggctgcttctggcgatctttttgtggcg
gtggtcggtcatcaggcggacgggcgtcgttatatcccgcaggcgattgcgcaaggtgtt
gctgccattattgctgaggctaaagatgaggcaaccgacggtgaaatccgtgaaatgcac
ggggtgccggtcatctatctcagccagttaaacgagcgtctttctgcgctggccggacgt
ttctatcacgaaccgtccgatcggctgcgtctggtgggcgtgacaggtacaaacggcaaa
accacgaccacgcagctcatggcgcagtgggcgcagctgctgggtgaaaccggtgcggtc
atgggaactgtcggtaacggtctgttgggcaaagtgagcccgaccgaaaacaccaccggc
tccgcggtcgacgtacagcacgtgctggccggcctggcagggcagggggcaacctttgcc
gcgatggaagtctcttcccacggtctggtgcagcaccgcgtggcggcgctgaagtttgcc
gcctcagtattcactaacctgagccgcgatcaccttgattatcatggtgatatggagcat
tacgaagcggcgaaatggctgctctactccacccaccatagcggacaggccatcatcaac
gctgacgacgaagtcggtcgccgctggctggcgaagctgccggatgcggttgcggtgtcg
atggaagaccatatcaacccgaactgccacggccgctggctgaaggcggttgcggtggat
tatcacgacagtggcgccaccattcgttttagctcctcatggggtgacggtgaaattgaa
agccgtctgatgggcgcgtttaacgtcagcaacctgctgctggcgctggcgacgctgctg
gcgctgggttatccgatgaacgcgctgctggaaacggctgagcgtttgcagccggtatgt
ggccgtatggaagtgttcagcgcgccgggcaaaccgaccgtggtggtcgattatgcccac
acgccggacgcactggaaaaagcactggaagcggcgcgtctgcactgcaccggtaagctc
tggtgtgtgtttggctgcggtggcgaccgtgataagggcaaacgtccactgatgggtgcc
attgctgaacagttcgcggatattccggttgtgaccgatgacaacccgcgtactgaagag
ccgcgcgccattattaacgacattctgtcgggcatgcttgatgcaggccgcgcccgcgtg
gtggaaggccgtgcggaagccgtgaccaacgccatcatgcaggctcaggaaaacgacgtt
gtgctgctggccgggaaaggccatgaggattatcagattgttggcaaccgtcgtctcgat
tattcggaccgcgtcacggccgcgcgtctgctgggagtcgtggcatga

DBGET integrated database retrieval system