KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00852Help
Entry
EcWSU1_00852      CDS       T01652                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eec01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eec00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
897188..898330
Genome map
AA seq 380 aa AA seqDB search
MTSFSLIVERQRIMSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVI
VTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRAD
MEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLL
LTDQQGLFTADPRSNPDAELITDVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRA
GIDTIIAAGSRPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGELTVDEGATAA
ILERGSSLLPKGIKSVTGNFSRGEVIRIRNLEGRDIAHGVSRYNSDALRRIAGHHSQQID
AILGYEYGPVAVHRDDMIIR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgacatcattttcccttatcgttgaacggcagagaatcatgagtgacagccagacgctg
gtggtaaaactcggtaccagtgttttaacaggcggatcgcgccgccttaatcgcgcccac
attgttgagcttgtacgtcagtgcgctcagttgcatgccgcagggcatcgtattgtaatt
gtgacctccggggcgattgccgccgggcgtgaacacctgggttaccccgaactccccgcg
acgatcgcctcgaaacagctgctggccgccgtgggacaaagccgactcattcaactctgg
gaacagctgttttctatctatggcatccacgtcgggcagatgctgctgacgcgtgcggat
atggaagaccgggagcgtttcctgaacgcgcgcgatacgctgcgcgcgctgctggataac
aacatcgttcccgtcattaacgaaaacgatgccgttgccaccgctgaaatcaaagtgggt
gataacgataacctctcggcgctggccgcaattctggcaggcgctgataaattactgctc
ctgaccgaccagcaggggctcttcaccgccgatccgcgttcaaatccggatgctgaactg
attaccgatgtacacggtatcgacgatgcgctacgcgccatcgcaggtgacagcgtttca
ggcctcggaaccggcggtatggggaccaagctgcaggctgccgacgtggcatgccgtgca
ggtatcgacaccatcattgccgcgggcagccgtcctggcgtaattggcgacgtgatggaa
ggcatctccgtgggaacccgcttccatgcgcaggcctccccgctggagaaccgcaaacgc
tggatctttggcgcaccgccggcaggcgaactcaccgttgatgaaggggcgaccgccgca
attctggaaagagggagctcattacttcctaaaggaattaaaagcgtgacaggcaacttc
tcacgtggtgaagtgatccgtatccgtaatctcgaaggtcgtgacatcgcccatggcgta
agccgctacaacagcgatgccctgcgccgtattgcgggtcaccattcacagcagatcgac
gccattctgggttatgaatatggcccggttgccgtgcatcgtgatgacatgattattcgt
taa

DBGET integrated database retrieval system