KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00888Help
Entry
EcWSU1_00888      CDS       T01652                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EcWSU1_00888 (hemB)
Enzymes [BR:eec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EcWSU1_00888 (hemB)
Exosome [BR:eec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcWSU1_00888 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(937242..938321)
Genome map
AA seq 359 aa AA seqDB search
MASGFPPRQNAHFGKTPSFTLRYTNPLCSTNLRHTMTDLIARPRRLRKSPALRAMFEETT
LTLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHT
DATGSDAWKEDGLVARMSRICKETVPEMVVMSDTCFCEYTSHGHCGVLCDHGVDNDATLL
NLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFR
EAAGTALKGDRKTYQMNPLNRREAIRESLLDEAQGADALMVKPAGAYLDILRDIRERTSL
PLGAYQVSGEYAMIKFAAMAGAIDEEKVILESLGAIKRAGADLIFSYFALDLAEKKILR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttggcatcgggatttccccctcgacaaaatgcccactttggtaaaacaccttctttcact
ttgaggtacactaaccctctttgttccacaaacctcaggcataccatgaccgatttaatt
gctcgtccccgtcgcctgcgcaagtcacccgcactacgcgctatgtttgaagagacaaca
ctgaccttaaacgatctggtgttgccgatttttgtcgaagaagagattgacgactacaag
gccatcgaagccatgcctggcgtgatgcgcattcctgaaaaacatctggcgcgtgaaatt
gaacgtatcgccaatgcagggatccgctcggtgatgaccttcggcatctcccatcatacc
gacgccaccggcagcgatgcctggaaagaggacggtctggtcgcccgtatgtcgcgcatt
tgcaaagagaccgtgccggaaatggtcgtgatgtccgacacctgtttctgcgaatacacc
tctcacggccactgcggcgtgctgtgcgatcacggtgtggataacgatgctaccctgctg
aatttaggtaagcaggcggtggttgctgccgctgcgggtgctgatttcatcgcgccatcg
gctgcgatggacgggcaggtgcaggctatccgccaggcgctggatgctgccggttttacc
gacacggccatcatgtcctactccaccaaatttgcctcctctttctacggcccgttccgt
gaagcagccggtacggcgctgaaaggcgatcgtaaaacgtatcagatgaacccgctcaac
cgtcgggaagctatccgtgaatccctgctcgatgaagcccagggcgcagacgccctgatg
gtgaaaccggcgggagcctatctcgatatcctgcgtgatattcgcgaacgcacctcgctg
ccgctgggcgcgtaccaggtcagcggcgagtacgcgatgatcaaattcgccgccatggcg
ggtgcgatcgatgaagagaaagtgatcctggaaagcctgggtgcgatcaaacgcgcgggt
gcggatctgatcttcagctactttgcgctggatctggctgagaagaaaattctgcgctaa

DBGET integrated database retrieval system