KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01009Help
Entry
EcWSU1_01009      CDS       T01652                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eec00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EcWSU1_01009 (recR)
DNA repair and recombination proteins [BR:eec03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EcWSU1_01009 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057308..1057913
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICTNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLESETIKEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgctcacgcagttaatggaagcactgcgctgtctgccgggtgtc
ggcccgaagtcggcgcagcgcatggcgtttacgctattgcagcgcgaccgcagcggcggg
atgcgcctggcgcaggctttgacccgtgccatgtcagaaattggtcactgtgcggattgc
cgtacctttaccgagcaggacgtgtgtaacatctgcactaatccgcgtcgtcaggaaaac
ggtcagatttgcgtggtggagagtccggcggacatctatgccatcgaacagaccgggcag
ttttctggccgctattttgtgctgatggggcatctctccccgctggacggtattggcccg
gacgatatcggtctcgatcgccttgaacagcgtcttgagtccgaaacgatcaaagaggtg
atcctcgccaccaacccaacggtggaaggggaagctacggccaactacatcgccgaattg
tgcgcacagtatggcgttgacgccagccgcatcgctcacggcgtgccagtgggcggtgag
ctggagatggtggacggcaccacgctgtcccactctctggctggacgtcacaagattatt
ttctga

DBGET integrated database retrieval system