KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01274Help
Entry
EcWSU1_01274      CDS       T01652                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00020  Citrate cycle (TCA cycle)
eec00310  Lysine degradation
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
eec01200  Carbon metabolism
Module
eec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EcWSU1_01274 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    EcWSU1_01274 (sucB)
Enzymes [BR:eec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EcWSU1_01274 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AEW72713
UniProt: G8LF13
Position
1338448..1339671
Genome map
AA seq 407 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVKRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSAGKESSAKSDEKASTPAQRQQASLEEQTNDALSPAIRR
LLAEHNLDAAAIKGTGVGGRLTREDIEKHLAKAPAQAEAKAPAAAAPAAQPALGARSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSFY
VKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKK
IKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
DGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcagatgcgaccgtc
gccacctggcacaaaaaaccgggcgatagcgttaagcgcgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcttcagcggatggcattctggatgcagtc
ctggaagacgaagggacaaccgtaacctcccgtcagatcctgggtcgcctgcgtgaaggc
aacagcgcgggcaaagagtccagcgcgaagtctgacgaaaaagcgtctaccccagcccag
cgtcagcaggcctctctggaagagcaaactaacgacgcgctcagcccggcgatccgtcgc
ctgctggccgagcacaacctggatgcggctgccattaaaggcaccggtgtcggtggtcgt
ctgacccgtgaagatatcgagaagcacctggcgaaagcccctgctcaggcagaagctaaa
gcgccagcagcagcggcgccggcagcacagcctgctctgggtgcccgtagcgaaaaacgc
gtgccgatgactcgcctgcgtaagcgtgtggctgagcgtctgctggaagcgaaaaactcc
accgcgatgctgaccaccttcaacgaagtgaatatgaagccaatcatggacctgcgtaag
cagtacggtgacgcgtttgaaaaacgtcacggtatccgtctgggctttatgtccttctac
gtgaaagcggttgttgaagcgctgaaacgctacccggaagttaacgcctctatcgatggc
gatgacgtggtttatcacaactacttcgacgtcagcatggcagtctctacgccacgtggt
ctggttaccccggttctgcgtgatgtcgatactctgggtatggctgacatcgagaaaaag
attaaagagctggctgtaaaaggtcgcgacggcaagctgaccgtagacgatctgaccggc
ggtaacttcaccattaccaacggcggcgttttcggttcactgatgtctaccccgatcatc
aacccgccgcagagcgcgatcctgggtatgcatgccattaaagatcgtccaatggcggta
gacggcaaagttgagatcctgccaatgatgtatctggcactctcttacgatcaccgtctg
atcgacggccgcgagtccgtgggcttcctggtggccattaaagagctgctggaagatcca
acgcgtctgctgctggacgtctag

DBGET integrated database retrieval system