KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01298Help
Entry
EcWSU1_01298      CDS       T01652                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcWSU1_01298 (gpmA)
   01230 Biosynthesis of amino acids
    EcWSU1_01298 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_01298 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EcWSU1_01298 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcWSU1_01298 (gpmA)
Enzymes [BR:eec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EcWSU1_01298 (gpmA)
Exosome [BR:eec04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EcWSU1_01298 (gpmA)
  Exosomal proteins of melanoma cells
   EcWSU1_01298 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1362535..1363323)
Genome map
AA seq 262 aa AA seqDB search
MLSFNKAYEEYDMAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAE
GFSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYG
DEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNET
ILPRLKSGERVIIAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHY
YLGNADEIAAKAAAVANQGKAK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgttatcattcaataaagcttatgaggagtacgatatggctgtaactaagctggtcctg
gtgcgtcatggcgaaagccagtggaacaacgaaaaccgctttaccggttggtacgacgtt
gatctgtcagaaaaaggcgtaagcgaagcaaaagcagcaggtaaactgctgaaggctgaa
ggcttcagctttgattttgcttacacctctgtgcttaaacgtgccatccatactctgtgg
aacgttctggacgaactggatcaggcctggctgccggttgagaaatcctggaaactgaac
gagcgtcactacggtgcgctgcagggtctgaacaaagcggaaaccgctgaaaaatacggt
gacgagcaggttaaacagtggcgtcgcggcttcgcggtaaccccaccagagctgaccaaa
gatgacgaacgctacccgggccacgacccgcgttacgcgaaactgacggatgctgagctg
ccaacgaccgagagcctggcgctgaccatcgaccgcgttgtgccttactggaacgaaacc
attctgccacgcctgaaaagcggcgagcgcgtgatcatcgcagctcacggtaactccctg
cgtgcgctggtgaaatacctggacaacatgggtgaagacgagatcctcgaactgaacatc
ccaactggcgttccgctggtgtatgagttcgacgaaaacttcaaaccaatcaaacattac
tatctgggcaacgctgatgagatcgctgcaaaagccgcggctgtagcgaaccagggtaaa
gcgaaataa

DBGET integrated database retrieval system