KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01299Help
Entry
EcWSU1_01299      CDS       T01652                                 

Gene name
galM
Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00010  Glycolysis / Gluconeogenesis
eec00052  Galactose metabolism
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
Module
eec_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_01299 (galM)
   00052 Galactose metabolism
    EcWSU1_01299 (galM)
Enzymes [BR:eec01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EcWSU1_01299 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEW72738
UniProt: G8LF38
Position
complement(1363494..1364537)
Genome map
AA seq 347 aa AA seqDB search
MLNETPTLAPDGLPYRLLTLRNSAGMVVTLMDWGATLLSARVPMPDGSVRETLLGCASPE
QYVNQSAYLGASVGRYANRIAKSAFELDGERYSLLSSQGENQLHGGPEGFDKRRWKIVQQ
NDREVLFSLDSRDGDQGFPGNLTAFAHFTLTDDNRIAIEYRAKVDKPCPVNLTNHAYFNL
DGNQCDVRNHTLQILADAYLPVDEMGIPYQGLKAVSDTSFDFRSGKTIAQDFLSDDDQRK
VKGYDHAFLLQAKGDVTQPAAQVWSADEKLQMTVYTTAPALQFYSGNYLGGTTAREHEEY
SDWQGLALESEFLPDSPNHPEWPQPDCVLRPGEEYVSVTEYHFIPHS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaacgaaacgccaacccttgccccggatggcctgccgtatcgcctgttaaccctg
cgcaacagcgcaggaatggtggttacgttaatggactggggtgccactttgctatccgct
cgcgtaccaatgcctgatggcagcgtacgtgaaaccctgcttggctgcgcgtcgcctgag
cagtatgtcaatcagtccgcctatcttggcgcgtctgtcggccgttatgctaaccgcatc
gcgaaaagcgctttcgaacttgatggcgagcgttactcgctgctttccagtcagggcgaa
aaccagttacacggtggacctgaagggttcgataagcgccgctggaaaatcgttcagcaa
aacgaccgcgaagtgctgttctcactagactcgcgtgacggtgaccagggattccccggt
aacctcaccgcgttcgcgcatttcacgctgactgacgataaccgtatcgccattgaatat
cgcgcgaaagttgataagccgtgcccggtcaatctgaccaaccacgcttatttcaacctg
gacggcaaccagtgcgacgtgcgtaatcacacgctccagatcctggccgatgcctatctg
ccggtggatgaaatggggatcccgtatcagggactcaaggccgtcagcgataccagcttt
gatttccgcagcggaaaaaccatcgcacaggatttcctgagcgatgacgatcagcgcaag
gtgaaaggctatgaccacgcgttcctgctgcaggcgaaaggcgatgtgactcagcctgcc
gcacaggtctggtctgcggatgaaaaactgcagatgacggtctacaccacggcccctgcc
ctgcaattctattcaggcaactaccttggcggtaccacggcacgcgaacatgaagagtac
agcgactggcaaggtctggcgctggaaagcgagttcctgccggacagcccgaaccatcca
gaatggccacagccggactgtgtgctgcgcccgggtgaagagtacgttagcgtgacagaa
tatcatttcatcccgcattcataa

DBGET integrated database retrieval system