KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01310Help
Entry
EcWSU1_01310      CDS       T01652                                 

Gene name
ybhC
Definition
acyl-CoA thioester hydrolase ybhC
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcWSU1_01310 (ybhC)
   00500 Starch and sucrose metabolism
    EcWSU1_01310 (ybhC)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     EcWSU1_01310 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1375313..1376596)
Genome map
AA seq 427 aa AA seqDB search
MNISRISRLALALAFGVTLSACSSTPPDQQPSEQVAPGTASRPILSADEAKNFDRAHYFS
AMDPNAAPWTPSSINLPKQPDFVVGPAGTQGVTHTTIQAAVDAAITKHSASRQYIAILPG
EYEGTVYVPAAPGSITLYGTGEKAVDVKIGLAIDSEIDSNTWRRLVNPAGKYMPGKPAWY
MFDNCQSKRAATIGVMCSAVVWSQNNGLQLQNLTIQNTLGDSVDAGNHQAVALRSDGDKV
QINNVNILGRQNTFFVTNSGVQNTLQNNRLTRTLVTNSYVEGDVDLVSGRGAVVFENTDF
RVVNSRTQQEGYVFAPATQSNLFYGFLAVNSRFNASGDGVAQLGRSLDVDSATNGQVVIR
DSVINEGFNMAKPWADAAISKRPFSGNTGSVDDKGNVQRNLNDANFNRMWEYNNRGLGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatttccaggatttcccgtctggcgttagcgctcgcctttggcgtgacattatcc
gcgtgcagttctaccccaccggaccagcagccttctgagcaggttgcaccgggtaccgcc
tctcgcccaattttgtccgctgatgaagcgaagaactttgaccgtgcacactacttctcg
gcgatggaccctaacgctgcgccgtggacaccgtcttctattaacctgccgaaacaacct
gacttcgttgtcggtccggcaggcacgcagggcgtgacgcacacgacgattcaggctgcg
gttgacgcggctatcaccaaacacagcgcctctcgccagtacatagcgatcctgcctggg
gaatatgaaggcaccgtttacgttccggcagcaccgggcagcatcaccctttacgggaca
ggcgagaaagcggtcgacgtgaaaattggtctggcgattgattctgaaatcgacagcaac
acctggcgtcgcctggtcaacccggcgggtaaatacatgccaggcaaaccggcgtggtac
atgtttgacaactgccagagcaagcgtgcagctaccatcggcgtgatgtgttcggcggtc
gtctggtctcagaataatggcctgcagctgcagaacctgaccattcagaataccctgggc
gatagcgttgatgcgggtaaccaccaggccgttgcactgcgtagcgatggcgataaagtg
cagatcaacaacgtgaatattctcggccgtcagaacaccttcttcgtgacgaacagcggt
gttcagaacacgctgcagaataaccgtctgacccgtacgctggtcactaacagctacgtt
gaaggtgacgtggatctggtctccggtcgcggcgcggtggtgtttgagaacaccgatttc
cgcgtggtgaattcacgcactcagcaggaaggttatgtgtttgcccctgccacgcaatct
aacctgttctacggcttcctggccgttaacagccgctttaacgcgtccggtgacggcgtc
gcgcagctgggccgctcgctggatgtggactctgccaccaacggtcaggttgttattcgt
gacagcgtgatcaacgaaggtttcaacatggctaagccatgggccgatgccgctatctcc
aaacgtcctttctccggcaataccggtagcgtggatgataaaggtaacgtgcagcgcaac
ctgaatgacgctaacttcaaccgcatgtgggaatacaacaaccgcggtctgggtagcaaa
gtggttgctgagcctaagcaataa

DBGET integrated database retrieval system