KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01590Help
Entry
EcWSU1_01590      CDS       T01652                                 

Gene name
ganA
Definition
beta-galactosidase ganA
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EcWSU1_01590 (ganA)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EcWSU1_01590 (ganA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667407..1669464
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLSSKVAALLHGADYNPEQWENYPGIIEKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGEYDFVWLDNVIDKLYSAGIHIFLATPSGARPAWMSQKYPQVLRVGRNRVPALHGGRHN
HCMSSPVYREKTFKMNSLLAERYSQHPAVLGWHISNEYGGECHCDLCQERFRDWLKARYK
TLDALNHAWWSTFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTDFCRHEVAP
LKAVNAALPVTTNFMEYFYDYDYWQLAKAIDFISWDSYPMWHKEKDETQLACYTAMYHDM
MRSLKGGKPFVLMESTPSTTNWQPTSKLKKPGMHILSSMQAVAHGADAVQYFQWRKSRGS
VEKFHGAVIDHVGHLDTRVGREVTRLGEMLERLPGVVGCRTQARVAIIFDQQNRWALDDA
EGPRNMGMEYEKTVNEHYRPFWEKGIAVDVIDADGDLSQYALVIAPMLYMVREGFAERAE
AFVAGGGHLVTTYWSGIVDESDLCHLGGFPGPLRKLLGIWAEEIDCLGEGERNLVQGLAG
NAAGLQGPYQVRHLCELIHVENAQPLATYRDDFYAGRPAVTVNRFGKGKAWHVASRNDLP
FQRDFFAGIIDELALPRAMECDFPPGVVATARTDGETTWVFVQNYTAQQQLITLPQGYTD
CMTDAAAAGDTALLPWDCRVLRRKA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcgcctttaagttcgaaggtcgctgcgttattgcatggcgccgactat
aacccggagcaatgggagaattaccccggtattattgaaaaagatattgccatgatgcag
caggcgaaatgtaatgtcatgtcggtgggcatatttagctgggcgaagctcgaaccgcgt
gaaggggaatatgattttgtctggctggataacgtcattgataaattatattcagcgggg
atccatattttcctcgccacgccgagcggtgcgcgcccggcatggatgtcgcaaaaatac
ccgcaggtgctgcgcgtagggcgtaaccgcgtgcctgcgctgcacggtgggcgtcataac
cactgtatgtcttccccggtgtaccgtgagaagacattcaaaatgaatagcttactggct
gagcgttattcacagcacccggcggtgctgggctggcatatctccaatgagtacggcggt
gagtgccactgcgatctgtgccaggagcgctttcgtgactggctgaaagcgcgctacaaa
accctggatgcgctgaaccacgcatggtggagcaccttctggagccacacctatagcgac
tggtcgcagattgagtcccctgcgccgcagggagaggtgtccattcacggtctgaacctc
gactggcgccgctttaatacggcgcaggtaacagatttctgtcgccatgaggttgcgccg
ctaaaagccgtcaacgcagcgttgccggtgacgaccaacttcatggagtacttctacgat
tacgactactggcagcttgcgaaagcgatcgactttatctcctgggacagctacccgatg
tggcacaaggagaaagacgaaacccagctcgcctgctacaccgccatgtaccacgacatg
atgcgcagcctgaaaggcggcaaaccttttgtgctgatggagtccacgccgagcaccacc
aactggcagccgaccagcaagctgaaaaagccggggatgcatattctctcgtcaatgcag
gcggtggcacacggggccgatgccgtacagtacttccagtggcgtaaaagccgcggttcg
gtggagaaattccacggggcggttatcgaccacgtggggcatcttgatacgcgtgtcggg
cgcgaagtgacgcgtctgggcgaaatgcttgagcgcctgccgggggtggtcgggtgtcgc
acgcaggcacgggtggcgattatcttcgaccagcaaaatcgctgggcgctggatgatgcc
gaagggccgcgcaacatggggatggagtacgaaaaaaccgttaacgaacactaccgtccg
ttctgggaaaaaggcatcgcggtggatgtgattgatgccgatggcgatctcagccagtac
gcgctggtgattgcgccgatgctttatatggtgcgggaaggctttgccgaacgcgcagaa
gcgtttgtcgccgggggcggccatctggtgaccacctactggagcggcatcgtggatgaa
agcgatctttgtcatctcggcgggttcccggggccgctgcgtaaactgctcggcatctgg
gcagaagagatcgactgtctcggtgagggagaacgtaatctggtacaggggctggcgggt
aatgcggctggcctgcaggggccgtatcaggttcgtcatctgtgcgaactgatccatgtc
gaaaacgctcagccgctggcgacctaccgggatgatttctacgccggtcggcctgccgtg
acggtgaaccgtttcggtaaggggaaagcgtggcatgtggcgtcgcgcaacgatctgccg
ttccagcgtgatttcttcgccgggattattgacgaactggcgctgccgcgggccatggaa
tgcgatttcccaccgggtgtagtggcaacggcccgcacggacggcgaaaccacgtgggtg
tttgtgcagaactacaccgcccagcagcagctcattacgctgccgcaggggtataccgac
tgcatgaccgatgccgccgccgcgggtgataccgctctgctgccgtgggattgtcgggta
ctcaggcgtaaagcgtag

DBGET integrated database retrieval system