KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01806Help
Entry
EcWSU1_01806      CDS       T01652                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00010  Glycolysis / Gluconeogenesis
eec00030  Pentose phosphate pathway
eec00051  Fructose and mannose metabolism
eec00052  Galactose metabolism
eec00680  Methane metabolism
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
eec01200  Carbon metabolism
eec01230  Biosynthesis of amino acids
Module
eec_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_01806 (pfkB)
   00030 Pentose phosphate pathway
    EcWSU1_01806 (pfkB)
   00051 Fructose and mannose metabolism
    EcWSU1_01806 (pfkB)
   00052 Galactose metabolism
    EcWSU1_01806 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    EcWSU1_01806 (pfkB)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EcWSU1_01806 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase DUF2617
Motif
Other DBs
NCBI-ProteinID: AEW73245
UniProt: G8LL90
Position
complement(1870422..1871357)
Genome map
AA seq 311 aa AA seqDB search
MMVSIYTLTLSPSLDSATLTPQIYPEGKLRCSAPVFEPGGGGINVARAITHLGGKATAIF
PAGGATGEHLVSLLADEQVASQTVESKDWTRQNLHVHVESSGEQYRFVMPGAKLSEDEFR
QLEEKVLAIESGALLVISGSLPPGVSTEKLTALIRAAQQRGIRCIVDSSGEALQAALTPG
NLELVKPNQKELSALVNRELNQPDDVLTAAQELVHSGKARRVVVSLGPQGALAVDETGSV
QVVPPPMKSQSTVGAGDSMVGAMTLKLAQGASLLEMTRYGVAAGSAATINQGTRLCSLSD
TQKIVDYLSRH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatggtttctatctacaccctgacgctctccccttccctcgactccgccaccctgacg
ccccagatttacccggaaggtaaattgcgctgcagcgccccggtgtttgagcccggcggc
ggtggtatcaatgtggcgcgagccataacgcacctcggtggaaaggcgacagcaattttc
cccgcaggcggcgcgaccggtgagcacctggtctctctgctggccgatgaacaggtggcc
tcgcagaccgtcgagtccaaagactggacgcggcaaaacctgcatgtgcacgtggagtcc
agcggcgagcaataccgtttcgtcatgccgggtgcaaaacttagtgaagatgagtttcgt
cagcttgaagagaaggtgctagccattgagagcggtgctctgctggtgataagcggcagc
ctgccgcccggtgtcagcacggaaaaactgacggcgctgattcgggccgcgcagcaacgc
ggtatccgctgcattgtcgacagcagcggcgaggcgctgcaggcagccctgacgccgggc
aatcttgagctggttaaacccaatcagaaagagttaagcgcgctggtgaaccgcgagctg
aaccagccggacgatgtcctcaccgccgcgcaggagctggttcacagcggcaaagcgcga
cgggtcgtggtctcccttggcccgcagggtgccctggccgtggacgaaacggggtccgtt
caggttgtcccgccgccgatgaaaagccagagtaccgtgggcgcaggtgatagcatggtt
ggagcgatgaccctgaaactggcccagggtgcttcattactggagatgacacgctacggc
gtcgcagcgggtagcgctgccaccatcaaccagggcacacgtctctgttcgcttagcgac
acgcaaaaaatcgtcgattacctgtcccgacattaa

DBGET integrated database retrieval system