KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01818Help
Entry
EcWSU1_01818      CDS       T01652                                 

Gene name
btuE
Definition
Vitamin B12 transport periplasmic protein BtuE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eec00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eec00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1882026..1882577
Genome map
AA seq 183 aa AA seqDB search
MQSDILNTEVTTIEGEKTTLESYKGNVLLIVNVASKCGLTPQYEQLENIQKAWEKDGFTV
LGFPCNQFLGQEPGSEDEIKTFCSTTYGVTFPMFSKIDVNGEHRHPLYAKLVAAAPTAVA
PEGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgatattttgaataccgaagtgaccaccattgagggtgagaaaaccacgctg
gaaagctataaaggcaacgtgctgctcatcgtgaatgtggcctccaaatgtggcctgacg
ccacagtacgagcagctggaaaacattcaaaaagcctgggagaaagacggtttcaccgta
ctgggcttcccgtgcaaccagttcctgggccaggagccgggcagcgaagacgaaatcaaa
acgttttgcagcaccacctacggtgtgacgttcccgatgttcagcaaaatcgacgttaac
ggtgaacatcgccatcccctgtatgcgaagctggtggcggccgcgccgaccgccgttgcg
ccggaaggcagcggtttttatgagcgcatggccagtaaaggacgcgcgccgctctatccg
gacgatatcctgtggaattttgaaaaattccttatcggtcgtgacggacaggtggtgcag
cgtttttcaccggacatgacgcctgaagatccgattgtgatggagtctatcaagctggcg
ctggcgaaataa

DBGET integrated database retrieval system