KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01823Help
Entry
EcWSU1_01823      CDS       T01652                                 

Gene name
hbdH1
Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    EcWSU1_01823 (hbdH1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    EcWSU1_01823 (hbdH1)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     EcWSU1_01823 (hbdH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1886443..1887309)
Genome map
AA seq 288 aa AA seqDB search
MAAFSLSPSSKVWRCFLSLPCSISPALCKENKMNLNGKTALVTGSTSGIGLGIAGVLAKA
GAQLILNGFGDSESARDEIAKRGKTPGYHDADLRDVQQIEAMMHYAETRYGGVDILINNA
GIQHVAPVDAFPVEKWNDIIAINLSSVFHTSRLALPAMQAKNWGRIINIASVHGLVASKE
KSAYVAAKHGVVGFTKSLALETARTGITANAICPGWVLTPLVQQQIDRRIADGVAPDVAR
EQLLAEKQPAGEFVTPEQLGELALFLCSDSAVQVRGAAWNMDGGWVAQ
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattttcgctatcaccctcatcaaaagtctggcggtgctttttgtcattgccg
tgttctatctcaccggcattgtgtaaggagaataaaatgaatctgaacggtaaaaccgca
ctggtgaccggctcgaccagcggtattggacttgggatcgctggcgtgctggcgaaggcc
ggcgcgcagttgattcttaacggtttcggcgacagtgaatcggcaagagacgaaatcgcg
aaacggggtaaaacgccgggctatcacgatgcggacctgcgtgacgtccagcagattgaa
gccatgatgcactacgccgaaacccggtatggcggagtcgatattctgatcaacaacgcc
ggtatacagcacgtcgcacctgttgatgcgttcccggtggagaaatggaacgacattatt
gccatcaacctctcttccgtctttcacaccagccggctggcgctgcctgcgatgcaggcg
aaaaactggggacgcatcattaatatcgcctccgtgcatgggctggtcgcgtcgaaagag
aaatccgcctatgttgccgccaagcatggcgtggtgggctttaccaaatccctggcgctg
gagaccgcccgcaccggtattaccgccaatgccatctgcccaggctgggtgctgaccccg
ctggtgcagcagcaaatcgacagacgtattgccgatggcgtcgcaccggatgtcgctcgt
gagcaactgctggcagagaaacagcccgccggtgagtttgttacgccggaacagctaggc
gagctggcgttgtttttgtgcagtgacagcgccgtacaggtccgcggcgccgcctggaat
atggatggcggatgggtcgcacagtga

DBGET integrated database retrieval system