KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01823Help
Entry
EcWSU1_01823      CDS       T01652                                 

Gene name
hbdH1
Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:eec00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:eec00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1886443..1887309)
Genome map
AA seq 288 aa AA seqDB search
MAAFSLSPSSKVWRCFLSLPCSISPALCKENKMNLNGKTALVTGSTSGIGLGIAGVLAKA
GAQLILNGFGDSESARDEIAKRGKTPGYHDADLRDVQQIEAMMHYAETRYGGVDILINNA
GIQHVAPVDAFPVEKWNDIIAINLSSVFHTSRLALPAMQAKNWGRIINIASVHGLVASKE
KSAYVAAKHGVVGFTKSLALETARTGITANAICPGWVLTPLVQQQIDRRIADGVAPDVAR
EQLLAEKQPAGEFVTPEQLGELALFLCSDSAVQVRGAAWNMDGGWVAQ
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattttcgctatcaccctcatcaaaagtctggcggtgctttttgtcattgccg
tgttctatctcaccggcattgtgtaaggagaataaaatgaatctgaacggtaaaaccgca
ctggtgaccggctcgaccagcggtattggacttgggatcgctggcgtgctggcgaaggcc
ggcgcgcagttgattcttaacggtttcggcgacagtgaatcggcaagagacgaaatcgcg
aaacggggtaaaacgccgggctatcacgatgcggacctgcgtgacgtccagcagattgaa
gccatgatgcactacgccgaaacccggtatggcggagtcgatattctgatcaacaacgcc
ggtatacagcacgtcgcacctgttgatgcgttcccggtggagaaatggaacgacattatt
gccatcaacctctcttccgtctttcacaccagccggctggcgctgcctgcgatgcaggcg
aaaaactggggacgcatcattaatatcgcctccgtgcatgggctggtcgcgtcgaaagag
aaatccgcctatgttgccgccaagcatggcgtggtgggctttaccaaatccctggcgctg
gagaccgcccgcaccggtattaccgccaatgccatctgcccaggctgggtgctgaccccg
ctggtgcagcagcaaatcgacagacgtattgccgatggcgtcgcaccggatgtcgctcgt
gagcaactgctggcagagaaacagcccgccggtgagtttgttacgccggaacagctaggc
gagctggcgttgtttttgtgcagtgacagcgccgtacaggtccgcggcgccgcctggaat
atggatggcggatgggtcgcacagtga

DBGET integrated database retrieval system