KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01946Help
Entry
EcWSU1_01946      CDS       T01652                                 

Gene name
folM
Definition
dihydrofolate reductase folM
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EcWSU1_01946 (folM)
   00670 One carbon pool by folate
    EcWSU1_01946 (folM)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EcWSU1_01946 (folM)
    1.5.1.-  
     EcWSU1_01946 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2007882..2008391)
Genome map
AA seq 169 aa AA seqDB search
MKSTTPGLRAIIHNASAWLPEKSGTPLSETLSCMLQIHVNAPYLLNHALLDLLRGHGHAA
GDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIAPAMILFNEDDD
AEYRQQALNKSLMKIAPGEKEVIDLIDYLLTSCYVTGRTFAVDGGRPLR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatctaccacccccgggctgcgcgccattatccataatgccagcgcctggcttccc
gaaaaatccggtacgccactcagcgaaacgctctcctgcatgctgcagatccacgtcaat
gcgccctatctgctgaaccatgccctgctcgacctgctgcgcggtcacggacatgcggcg
ggtgatattattcatttcaccgattacgtcgtggagcgcggcagcgacaagcacatcgcc
tatgcggccagtaaagccgcactcgataacatgacgcgctcgttcgcgcgtaaacttgcc
cctgaagttaaggtgaacgccatcgccccggcgatgattttattcaacgaagacgatgat
gcggagtatcgccagcaggcgctaaataaatcgctgatgaaaattgcgccaggtgaaaaa
gaggttatcgatcttatcgattatctgctcaccagttgctacgtcactggcagaaccttt
gccgtggacggcggtcgaccgttgcgctag

DBGET integrated database retrieval system